ports/misc/qt5-doc/pkg-plist
Tobias C. Berner f3c180c343 Update Qt5 to 5.7.1, and unify the Qt4 and Qt5 ports some more
* Update Qt5 to 5.7.1
* Move Qt4 binaries to lib/qt4/bin
* Move Qt5 libraries to lib/qt5/lib
  By moving the libraries we should finally be able to get rid of the inplace
  upgrade bug (see ports bugs 194088, 195105 and 198720):  when Qt5's libraries
  were lying in /usr/local/lib, which would often get added by pkgconfig to the
  linker paths via dependencies, the already installed libraries were linked
  against, instead of the ones that were being built. This forced us to make
  sure, that -L${WRKSRC}/lib was always coming before -L/usr/local/lib in the
  linker flags. With this change this should no longer be the case.
* Rename some ports to match the rest (foo-qtX -> qtX-foo)
* Depend on new port misc/qtchooser [see UPDATING & CHANGES]

There are several new Qt5 ports which all have been created by Marie Loise Nolden
<nolden@kde.org>. Thanks again.

PR:		216797
Exp-Run by:	antoine
Reviewed by:	rakuco, mat, groot_kde.org
Approved by:	rakuco (mentor)
Differential Revision:	https://reviews.freebsd.org/D9213
2017-02-18 19:48:05 +00:00

14281 lines
843 KiB
Text

%%QT_DOCDIR%%/Makefile
%%QT_DOCDIR%%/activeqt.qch
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-comapp-comapp-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-comapp-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-comapp-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-hierarchy-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-hierarchy-hierarchy-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-hierarchy-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-hierarchy-objects-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-hierarchy-objects-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-menus-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-menus-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-menus-menus-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-menus-menus-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-menus-menus-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-multiple-ax1-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-multiple-ax2-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-multiple-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-multiple-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-multiple-multiple-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-glbox-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-glbox-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-globjwin-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-globjwin-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-opengl-opengl-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-qutlook-addressview-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-qutlook-addressview-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-qutlook-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-qutlook-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-qutlook-qutlook-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-simple-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-simple-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-simple-simple-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-webbrowser-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-webbrowser-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-webbrowser-mainwindow-ui.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-webbrowser-webaxwidget-h.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-webbrowser-webbrowser-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-wrapper-example.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-wrapper-main-cpp.html
%%QT_DOCDIR%%/activeqt/activeqt-activeqt-wrapper-wrapper-pro.html
%%QT_DOCDIR%%/activeqt/activeqt-container.html
%%QT_DOCDIR%%/activeqt/activeqt-dotnet.html
%%QT_DOCDIR%%/activeqt/activeqt-dumpcpp.html
%%QT_DOCDIR%%/activeqt/activeqt-dumpdoc.html
%%QT_DOCDIR%%/activeqt/activeqt-index.html
%%QT_DOCDIR%%/activeqt/activeqt-server.html
%%QT_DOCDIR%%/activeqt/activeqt-tools.html
%%QT_DOCDIR%%/activeqt/activeqt.index
%%QT_DOCDIR%%/activeqt/activeqt.qhp
%%QT_DOCDIR%%/activeqt/activeqt.qhp.sha1
%%QT_DOCDIR%%/activeqt/activeqt.tags
%%QT_DOCDIR%%/activeqt/examples-manifest.xml
%%QT_DOCDIR%%/activeqt/images/activeqt-webbrowser-example.png
%%QT_DOCDIR%%/activeqt/images/arrow_bc.png
%%QT_DOCDIR%%/activeqt/images/bgrContent.png
%%QT_DOCDIR%%/activeqt/images/btn_next.png
%%QT_DOCDIR%%/activeqt/images/btn_prev.png
%%QT_DOCDIR%%/activeqt/images/bullet_dn.png
%%QT_DOCDIR%%/activeqt/images/bullet_sq.png
%%QT_DOCDIR%%/activeqt/images/home.png
%%QT_DOCDIR%%/activeqt/images/ico_note.png
%%QT_DOCDIR%%/activeqt/images/ico_note_attention.png
%%QT_DOCDIR%%/activeqt/images/ico_out.png
%%QT_DOCDIR%%/activeqt/images/logo.png
%%QT_DOCDIR%%/activeqt/qaxaggregated-members.html
%%QT_DOCDIR%%/activeqt/qaxaggregated.html
%%QT_DOCDIR%%/activeqt/qaxbase-members.html
%%QT_DOCDIR%%/activeqt/qaxbase.html
%%QT_DOCDIR%%/activeqt/qaxbindable-members.html
%%QT_DOCDIR%%/activeqt/qaxbindable.html
%%QT_DOCDIR%%/activeqt/qaxcontainer-module.html
%%QT_DOCDIR%%/activeqt/qaxfactory-members.html
%%QT_DOCDIR%%/activeqt/qaxfactory.html
%%QT_DOCDIR%%/activeqt/qaxobject-members.html
%%QT_DOCDIR%%/activeqt/qaxobject.html
%%QT_DOCDIR%%/activeqt/qaxscript-members.html
%%QT_DOCDIR%%/activeqt/qaxscript.html
%%QT_DOCDIR%%/activeqt/qaxscriptengine-members.html
%%QT_DOCDIR%%/activeqt/qaxscriptengine.html
%%QT_DOCDIR%%/activeqt/qaxscriptmanager-members.html
%%QT_DOCDIR%%/activeqt/qaxscriptmanager.html
%%QT_DOCDIR%%/activeqt/qaxselect-members.html
%%QT_DOCDIR%%/activeqt/qaxselect.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-hierarchy.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-menus.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-multiple.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-opengl.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-simple.html
%%QT_DOCDIR%%/activeqt/qaxserver-demo-wrapper.html
%%QT_DOCDIR%%/activeqt/qaxserver-module.html
%%QT_DOCDIR%%/activeqt/qaxwidget-members.html
%%QT_DOCDIR%%/activeqt/qaxwidget.html
%%QT_DOCDIR%%/activeqt/style/offline-simple.css
%%QT_DOCDIR%%/activeqt/style/offline.css
%%QT_DOCDIR%%/qdoc.qch
%%QT_DOCDIR%%/qdoc/01-qdoc-manual.html
%%QT_DOCDIR%%/qdoc/03-qdoc-commands-markup.html
%%QT_DOCDIR%%/qdoc/04-qdoc-commands-textmarkup.html
%%QT_DOCDIR%%/qdoc/05-qdoc-commands-documentstructure.html
%%QT_DOCDIR%%/qdoc/06-qdoc-commands-includecodeinline.html
%%QT_DOCDIR%%/qdoc/07-0-qdoc-commands-includingexternalcode.html
%%QT_DOCDIR%%/qdoc/08-qdoc-commands-creatinglinks.html
%%QT_DOCDIR%%/qdoc/09-qdoc-commands-includingimages.html
%%QT_DOCDIR%%/qdoc/10-qdoc-commands-tablesandlists.html
%%QT_DOCDIR%%/qdoc/11-qdoc-commands-specialcontent.html
%%QT_DOCDIR%%/qdoc/12-0-qdoc-commands-miscellaneous.html
%%QT_DOCDIR%%/qdoc/13-qdoc-commands-topics.html
%%QT_DOCDIR%%/qdoc/14-qdoc-commands-contextcommands.html
%%QT_DOCDIR%%/qdoc/15-qdoc-commands-navigation.html
%%QT_DOCDIR%%/qdoc/16-qdoc-commands-status.html
%%QT_DOCDIR%%/qdoc/17-qdoc-commands-thread.html
%%QT_DOCDIR%%/qdoc/18-qdoc-commands-relating.html
%%QT_DOCDIR%%/qdoc/19-qdoc-commands-grouping.html
%%QT_DOCDIR%%/qdoc/20-qdoc-commands-namingthings.html
%%QT_DOCDIR%%/qdoc/21-0-qdoc-configuration.html
%%QT_DOCDIR%%/qdoc/21-0-qdoc-creating-dita-maps.html
%%QT_DOCDIR%%/qdoc/21-1-minimum-qdocconf.html
%%QT_DOCDIR%%/qdoc/21-2-qtgui-qdocconf.html
%%QT_DOCDIR%%/qdoc/21-3-qt-dita-xml-output.html
%%QT_DOCDIR%%/qdoc/22-creating-help-project-files.html
%%QT_DOCDIR%%/qdoc/22-qdoc-configuration-generalvariables.html
%%QT_DOCDIR%%/qdoc/23-qdoc-configuration-cppvariables.html
%%QT_DOCDIR%%/qdoc/24-qdoc-configuration-htmlvariables.html
%%QT_DOCDIR%%/qdoc/25-qdoc-configuration-derivedprojects.html
%%QT_DOCDIR%%/qdoc/26-qdoc-configuration-example-manifest-files.html
%%QT_DOCDIR%%/qdoc/27-qdoc-commands-alphabetical.html
%%QT_DOCDIR%%/qdoc/28-qdoc-qa-pages.html
%%QT_DOCDIR%%/qdoc/corefeatures.html
%%QT_DOCDIR%%/qdoc/examples-manifest.xml
%%QT_DOCDIR%%/qdoc/images/arrow_bc.png
%%QT_DOCDIR%%/qdoc/images/bgrContent.png
%%QT_DOCDIR%%/qdoc/images/btn_next.png
%%QT_DOCDIR%%/qdoc/images/btn_prev.png
%%QT_DOCDIR%%/qdoc/images/bullet_dn.png
%%QT_DOCDIR%%/qdoc/images/bullet_sq.png
%%QT_DOCDIR%%/qdoc/images/happy.gif
%%QT_DOCDIR%%/qdoc/images/happyguy.jpg
%%QT_DOCDIR%%/qdoc/images/home.png
%%QT_DOCDIR%%/qdoc/images/ico_note.png
%%QT_DOCDIR%%/qdoc/images/ico_note_attention.png
%%QT_DOCDIR%%/qdoc/images/ico_out.png
%%QT_DOCDIR%%/qdoc/images/link-to-qquickitem.png
%%QT_DOCDIR%%/qdoc/images/links-to-links.png
%%QT_DOCDIR%%/qdoc/images/logo.png
%%QT_DOCDIR%%/qdoc/images/qa-table.png
%%QT_DOCDIR%%/qdoc/images/training.jpg
%%QT_DOCDIR%%/qdoc/images/windowsvista-pushbutton.png
%%QT_DOCDIR%%/qdoc/images/windowsvista-toolbutton.png
%%QT_DOCDIR%%/qdoc/qdoc-categories.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-componentset-pro.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-example.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-progressbar-qml.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-switch-qml.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-tabwidget-qml.html
%%QT_DOCDIR%%/qdoc/qdoc-componentset-uicomponents-qdoc-sample.html
%%QT_DOCDIR%%/qdoc/qdoc-guide-conf.html
%%QT_DOCDIR%%/qdoc/qdoc-guide-writing.html
%%QT_DOCDIR%%/qdoc/qdoc-guide.html
%%QT_DOCDIR%%/qdoc/qdoc-index.html
%%QT_DOCDIR%%/qdoc/qdoc-minimum-qdocconf.html
%%QT_DOCDIR%%/qdoc/qdoc.index
%%QT_DOCDIR%%/qdoc/qdoc.qhp
%%QT_DOCDIR%%/qdoc/qdoc.qhp.sha1
%%QT_DOCDIR%%/qdoc/qdoc.tags
%%QT_DOCDIR%%/qdoc/qml-uicomponents-progressbar-members.html
%%QT_DOCDIR%%/qdoc/qml-uicomponents-progressbar.html
%%QT_DOCDIR%%/qdoc/qml-uicomponents-switch-members.html
%%QT_DOCDIR%%/qdoc/qml-uicomponents-switch.html
%%QT_DOCDIR%%/qdoc/qml-uicomponents-tabwidget-members.html
%%QT_DOCDIR%%/qdoc/qml-uicomponents-tabwidget.html
%%QT_DOCDIR%%/qdoc/qtgui-qdocconf.html
%%QT_DOCDIR%%/qdoc/qtwritingstyle-cpp.html
%%QT_DOCDIR%%/qdoc/qtwritingstyle-qml.html
%%QT_DOCDIR%%/qdoc/style/offline-simple.css
%%QT_DOCDIR%%/qdoc/style/offline.css
%%QT_DOCDIR%%/qdoc/uicomponents-qmlmodule.html
%%QT_DOCDIR%%/qmake.qch
%%QT_DOCDIR%%/qmake/images/arrow_bc.png
%%QT_DOCDIR%%/qmake/images/bgrContent.png
%%QT_DOCDIR%%/qmake/images/btn_next.png
%%QT_DOCDIR%%/qmake/images/btn_prev.png
%%QT_DOCDIR%%/qmake/images/bullet_dn.png
%%QT_DOCDIR%%/qmake/images/bullet_sq.png
%%QT_DOCDIR%%/qmake/images/home.png
%%QT_DOCDIR%%/qmake/images/ico_note.png
%%QT_DOCDIR%%/qmake/images/ico_note_attention.png
%%QT_DOCDIR%%/qmake/images/ico_out.png
%%QT_DOCDIR%%/qmake/images/logo.png
%%QT_DOCDIR%%/qmake/images/qmake-precompile-ui.png
%%QT_DOCDIR%%/qmake/qmake-advanced-usage.html
%%QT_DOCDIR%%/qmake/qmake-common-projects.html
%%QT_DOCDIR%%/qmake/qmake-environment-reference.html
%%QT_DOCDIR%%/qmake/qmake-function-reference.html
%%QT_DOCDIR%%/qmake/qmake-language.html
%%QT_DOCDIR%%/qmake/qmake-manual.html
%%QT_DOCDIR%%/qmake/qmake-overview.html
%%QT_DOCDIR%%/qmake/qmake-platform-notes.html
%%QT_DOCDIR%%/qmake/qmake-precompiledheaders.html
%%QT_DOCDIR%%/qmake/qmake-project-files.html
%%QT_DOCDIR%%/qmake/qmake-reference.html
%%QT_DOCDIR%%/qmake/qmake-running.html
%%QT_DOCDIR%%/qmake/qmake-test-function-reference.html
%%QT_DOCDIR%%/qmake/qmake-tutorial.html
%%QT_DOCDIR%%/qmake/qmake-variable-reference.html
%%QT_DOCDIR%%/qmake/qmake.index
%%QT_DOCDIR%%/qmake/qmake.qhp
%%QT_DOCDIR%%/qmake/qmake.qhp.sha1
%%QT_DOCDIR%%/qmake/style/offline-simple.css
%%QT_DOCDIR%%/qmake/style/offline.css
%%QT_DOCDIR%%/qt3d.qch
%%QT_DOCDIR%%/qt3d/examples-manifest.xml
%%QT_DOCDIR%%/qt3d/images/Space-invaders.jpg
%%QT_DOCDIR%%/qt3d/images/arrow_bc.png
%%QT_DOCDIR%%/qt3d/images/audio-visualizer-qml-example.png
%%QT_DOCDIR%%/qt3d/images/basicshapes-cpp-example.jpg
%%QT_DOCDIR%%/qt3d/images/bgrContent.png
%%QT_DOCDIR%%/qt3d/images/btn_next.png
%%QT_DOCDIR%%/qt3d/images/btn_prev.png
%%QT_DOCDIR%%/qt3d/images/bullet_dn.png
%%QT_DOCDIR%%/qt3d/images/bullet_sq.png
%%QT_DOCDIR%%/qt3d/images/deferred-framegraph.png
%%QT_DOCDIR%%/qt3d/images/ecs-1.png
%%QT_DOCDIR%%/qt3d/images/ecs-2.png
%%QT_DOCDIR%%/qt3d/images/framegraph-parallel-build.png
%%QT_DOCDIR%%/qt3d/images/home.png
%%QT_DOCDIR%%/qt3d/images/ico_note.png
%%QT_DOCDIR%%/qt3d/images/ico_note_attention.png
%%QT_DOCDIR%%/qt3d/images/ico_out.png
%%QT_DOCDIR%%/qt3d/images/logo.png
%%QT_DOCDIR%%/qt3d/images/materials-cpp.png
%%QT_DOCDIR%%/qt3d/images/materials.png
%%QT_DOCDIR%%/qt3d/images/multiviewport-1.png
%%QT_DOCDIR%%/qt3d/images/multiviewport-2.png
%%QT_DOCDIR%%/qt3d/images/multiviewport-qml-example.png
%%QT_DOCDIR%%/qt3d/images/multiviewport.png
%%QT_DOCDIR%%/qt3d/images/planets-qml-example.jpg
%%QT_DOCDIR%%/qt3d/images/qt3d-wireframe-rendering.png
%%QT_DOCDIR%%/qt3d/images/scene3d.png
%%QT_DOCDIR%%/qt3d/images/shadowmapping-depth.png
%%QT_DOCDIR%%/qt3d/images/shadowmapping-qt3d.png
%%QT_DOCDIR%%/qt3d/images/simple-cpp.png
%%QT_DOCDIR%%/qt3d/images/simple-framegraph.png
%%QT_DOCDIR%%/qt3d/images/simple-qml.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/albumcover.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/demotitle.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/normalmap.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausehoverpressed.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausenormal.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/playhoverpressed.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/playnormal.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/songtitle.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopdisabled.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/stophoverpressed.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopnormal.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earth.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earthcloudmapcolortrans.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earthcloudmapspec.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earthmap1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earthnormal1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/earthspec1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/galaxy_starfield.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/jupiter.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/jupitermap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/mars.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/marsmap1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/marsnormal1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/mercury.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/mercurymap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/mercurynormal.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/moonmap1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/moonnormal1k.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/neptune.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/neptunemap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/saturn.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/saturnmap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/saturnringcolortrans.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/sun.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/sunmap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/uranus.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/uranusmap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/uranusringcolortrans.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/venus.png
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/venusmap.jpg
%%QT_DOCDIR%%/qt3d/images/used-in-examples/planets-qml/images/venusnormal.jpg
%%QT_DOCDIR%%/qt3d/images/wave.png
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-component3d-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-component3d.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-entity-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-entity.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-entityloader-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-entityloader.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-node-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-node.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-nodeinstantiator-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-nodeinstantiator.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-quaternionanimation-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-quaternionanimation.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-transform-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-core-transform.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-conegeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-conegeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-conemesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-conemesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cuboidgeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cuboidmesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cuboidmesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cylindergeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cylindergeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cylindermesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-cylindermesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-diffusemapmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-forwardrenderer-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-forwardrenderer.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-goochmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-goochmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-orbitcameracontroller.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-phongalphamaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-phongmaterial-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-phongmaterial.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-planegeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-planegeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-planemesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-planemesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-spheregeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-spheregeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-spheremesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-spheremesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-torusgeometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-torusgeometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-torusmesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-extras-torusmesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractactioninput-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractactioninput.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractaxisinput.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-abstractphysicaldevice.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-action-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-action.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-actioninput-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-actioninput.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-analogaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-analogaxisinput.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-axis-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-axis.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-axissetting-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-axissetting.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-buttonaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-buttonaxisinput.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputchord-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputchord.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputsequence-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputsequence.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputsettings-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-inputsettings.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyboarddevice-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyboarddevice.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyboardhandler-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyboardhandler.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyevent-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-keyevent.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-logicaldevice-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-logicaldevice.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mousedevice-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mousedevice.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mouseevent-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mouseevent.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mousehandler-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-mousehandler.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-wheelevent-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-input-wheelevent.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-logic-frameaction-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-logic-frameaction.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-abstracttextureimage-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-abstracttextureimage.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-attribute-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-attribute.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-blendequation-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-blendequation.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-blendequationarguments-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-blendequationarguments.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-buffer-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-buffer.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-camera-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-camera.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-cameralens-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-cameralens.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-cameraselector-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-cameraselector.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-clearbuffers-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-clearbuffers.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-clipplane-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-clipplane.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-directionallight-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-directionallight.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-dispatchcompute-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-dispatchcompute.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-effect-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-effect.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-filterkey-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-filterkey.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-framegraphnode-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-framegraphnode.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-frustumculling-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-frustumculling.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-geometry-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-geometry.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-geometryrenderer-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-geometryrenderer.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-graphicsapifilter-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-graphicsapifilter.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-layer-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-layer.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-layerfilter-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-layerfilter.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-light-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-light.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-material-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-material.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-mesh-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-mesh.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-nodraw-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-nodraw.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-objectpicker-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-objectpicker.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-parameter-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-parameter.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pickevent-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pickevent.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pickingsettings-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pickingsettings.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-picktriangleevent-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-picktriangleevent.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pointlight-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pointlight.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pointsize-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-pointsize.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-renderpass-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-renderpass.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendersettings-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendersettings.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendersurfaceselector.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendertargetselector-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-rendertargetselector.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-sceneloader-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-sceneloader.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-shaderprogram-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-shaderprogram.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-sortpolicy-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-sortpolicy.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-spotlight-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-spotlight.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-technique-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-technique.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-textureimage-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-textureimage.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-viewport-members.html
%%QT_DOCDIR%%/qt3d/qml-qt3d-render-viewport.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-barentity-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-example.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-touchsettings-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-touchsettings-h.html
%%QT_DOCDIR%%/qt3d/qt3d-audio-visualizer-qml-visualizer-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-basicshapes-cpp-example.html
%%QT_DOCDIR%%/qt3d/qt3d-basicshapes-cpp-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-basicshapes-cpp-scenemodifier-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-basicshapes-cpp-scenemodifier-h.html
%%QT_DOCDIR%%/qt3d/qt3d-core-qmlmodule.html
%%QT_DOCDIR%%/qt3d/qt3d-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-deferred-renderer-cpp-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-deferred-renderer-cpp-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-example.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-final-gl2-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-final-gl3-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-finaleffect-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-finaleffect-h.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-gbuffer-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-gbuffer-h.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-geometry-gl2-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-geometry-gl3-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-pointlightblock-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-pointlightblock-h.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-sceneeffect-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-deferred-renderer-cpp-sceneeffect-h.html
%%QT_DOCDIR%%/qt3d/qt3d-examples.html
%%QT_DOCDIR%%/qt3d/qt3d-extras-qmlmodule.html
%%QT_DOCDIR%%/qt3d/qt3d-index.html
%%QT_DOCDIR%%/qt3d/qt3d-input-qmlmodule.html
%%QT_DOCDIR%%/qt3d/qt3d-logic-qmlmodule.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-barrel-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-basiccamera-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-chest-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-barrel-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-barrel-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-example.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-houseplant-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-houseplant-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-materials-cpp-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-planeentity-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-planeentity-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-renderableentity-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-renderableentity-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-rotatingtrefoilknot-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-trefoilknot-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-cpp-trefoilknot-h.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-example.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-houseplant-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-lights-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-materials-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-materials-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-planeentity-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-renderableentity-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-sortedforwardrenderer-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-materials-trefoilknot-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-example.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-multiviewport-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-multiviewport-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-quadviewportframegraph-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-multiviewport-simplecamera-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-overview.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-example.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-fpsdisplay-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-infosheet-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planet-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planetbutton-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planeteffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planetframegraph-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planetmaterial-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planets-js.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planets-qml-images-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planets-qml-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planets-qml-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planetslight-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-planetsmain-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-ring-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-es2-planetd-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-es2-planetdb-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-es2-sun-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-gl3-planetd-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-gl3-planetdb-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shaders-gl3-sun-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-shadoweffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-solarsystem-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-styledslider-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-planets-qml-suneffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-render-qmlmodule.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-animatedentity-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-example.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-scene3d-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-scene3d-scene3d-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-adseffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-adsmaterial-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-example.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-groundplane-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shaders-ads-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shaders-es3-ads-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shaders-shadowmap-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shadow-map-qml-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shadow-map-qml-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shadowmapframegraph-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-shadowmaplight-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-toyplane-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-shadow-map-qml-trefoil-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-cpp-example.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-cpp-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-cpp-orbittransformcontroller-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-cpp-orbittransformcontroller-h.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-cpp-simple-cpp-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-cameracontroller-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-example.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-simple-qml-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-simple-qml-simple-qml-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-background-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-backgroundeffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-basiccamera-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-example.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-shaders-background-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-shaders-ribbon-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-shaders-robustwireframe-geom.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-wave-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-wave-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-wave-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-waveeffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-waveforwardrenderer-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wave-wavematerial-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-basiccamera-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-example.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-main-cpp.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-main-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-shaders-robustwireframe-geom.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-shaders-robustwireframe-vert.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-trefoilknot-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-wireframe-pro.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-wireframe-qrc.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-wireframeeffect-qml.html
%%QT_DOCDIR%%/qt3d/qt3d-wireframe-wireframematerial-qml.html
%%QT_DOCDIR%%/qt3d/qt3d.index
%%QT_DOCDIR%%/qt3d/qt3d.qhp
%%QT_DOCDIR%%/qt3d/qt3d.qhp.sha1
%%QT_DOCDIR%%/qt3d/qt3d.tags
%%QT_DOCDIR%%/qt3d/qt3dcore-arrayallocatingpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-arrayallocatingpolicy.html
%%QT_DOCDIR%%/qt3d/qt3dcore-arraypreallocationpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-arraypreallocationpolicy.html
%%QT_DOCDIR%%/qt3d/qt3dcore-aspecttaskrunnable-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-aspecttaskrunnable.html
%%QT_DOCDIR%%/qt3d/qt3dcore-circularbufferdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-circularbufferdata.html
%%QT_DOCDIR%%/qt3d/qt3dcore-debug-asynchronouscommandreply-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-debug-asynchronouscommandreply.html
%%QT_DOCDIR%%/qt3d/qt3dcore-debug.html
%%QT_DOCDIR%%/qt3d/qt3dcore-dependency-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-dependency.html
%%QT_DOCDIR%%/qt3d/qt3dcore-dependencyhandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-dependencyhandler.html
%%QT_DOCDIR%%/qt3d/qt3dcore-int2type-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-int2type.html
%%QT_DOCDIR%%/qt3d/qt3dcore-module.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-locker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-locker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-readlocker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-readlocker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-writelocker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy-writelocker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nonlockingpolicy.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nullopenglinformationservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nullopenglinformationservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nullsysteminformationservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-nullsysteminformationservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-locker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-locker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-readlocker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-readlocker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-writelocker-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy-writelocker.html
%%QT_DOCDIR%%/qt3d/qt3dcore-objectlevellockingpolicy.html
%%QT_DOCDIR%%/qt3d/qt3dcore-propertychangehandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-propertychangehandler.html
%%QT_DOCDIR%%/qt3d/qt3dcore-propertychangehandlerbase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-propertychangehandlerbase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractarbiter-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractarbiter.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspect-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspect.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspectjobmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspectjobmanager.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspectprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractaspectprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractframeadvanceservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractframeadvanceservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractframeadvanceserviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractframeadvanceserviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractnodefactory-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractnodefactory.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractpostman-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractpostman.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractserviceprovider-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractserviceprovider.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractserviceproviderprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qabstractserviceproviderprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectengine-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectengine.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectengineprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectengineprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectfactory-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectfactory.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjob.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobmanager.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobproviderinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectjobproviderinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectmanager.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectthread-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qaspectthread.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnode-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnode.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodefactory-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodefactory.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodemapper-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodemapper.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qbackendnodeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qboundedcircularbuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qboundedcircularbuffer.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qchangearbiter-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qchangearbiter.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer-const-iterator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer-const-iterator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer-iterator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer-iterator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcircularbuffer.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponent-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponent.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentaddedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentaddedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentaddedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentaddedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentremovedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentremovedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentremovedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qcomponentremovedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdestructionidandtypecollector-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdestructionidandtypecollector.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdynamicpropertyupdatedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qdynamicpropertyupdatedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentity-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentity.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentitydata-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentitydata.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentityprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qentityprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qeventfilterservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qeventfilterservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qfixedframeallocator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qfixedframeallocator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframeallocator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframeallocator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframeallocatorprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframeallocatorprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframechunk-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qframechunk.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qhandle-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qhandle.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qhandlemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qhandlemanager.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qlockableobserverinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qlockableobserverinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnode-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnode.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangegenerator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodecreatedchangegenerator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodedestroyedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodedestroyedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodedestroyedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodedestroyedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeid-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeid.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeidtypepair-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeidtypepair.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodevisitor-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qnodevisitor.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qobservableinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qobservableinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qobserverinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qobserverinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qopenglinformationservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qopenglinformationservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qopenglinformationserviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qopenglinformationserviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpostman-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpostman.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynodeaddedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynodeaddedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynodeaddedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynoderemovedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynoderemovedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertynoderemovedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyupdatedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueaddedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qpropertyvalueremovedchangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qresourceinfo-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qresourceinfo.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qresourcemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qresourcemanager.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscene-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscene.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscenechange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscenechange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscenechangeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscenechangeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsceneobserverinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsceneobserverinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscheduler-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qscheduler.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qservicelocator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qservicelocator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyupdatedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyupdatedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsysteminformationservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsysteminformationservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsysteminformationserviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qsysteminformationserviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qthreadpooler-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qthreadpooler.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtickclock-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtickclock.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtickclockservice-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtickclockservice.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransform-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransform.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransformdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransformdata.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransformprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtransformprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtypedpropertyupdatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-qtypedpropertyupdatedchange.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qqmlaspectengine.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qqmlaspectengineprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qqmlaspectengineprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qquaternionanimation-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-qquaternionanimation.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dcolorvaluetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dcolorvaluetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentity-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentity.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentityloader-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentityloader.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentityloaderprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dentityloaderprivate.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dmatrix4x4valuetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dmatrix4x4valuetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dnode-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dnode.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dnodeinstantiator-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dnodeinstantiator.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dquaternionvaluetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dquaternionvaluetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvaluetypes.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector2dvaluetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector2dvaluetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector3dvaluetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector3dvaluetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector4dvaluetype-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick-quick3dvector4dvaluetype.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quick.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quicknodefactory-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-quicknodefactory.html
%%QT_DOCDIR%%/qt3d/qt3dcore-runnableinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-runnableinterface.html
%%QT_DOCDIR%%/qt3d/qt3dcore-synctaskrunnable-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-synctaskrunnable.html
%%QT_DOCDIR%%/qt3d/qt3dcore-typedcircularbufferdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dcore-typedcircularbufferdata.html
%%QT_DOCDIR%%/qt3d/qt3dcore.html
%%QT_DOCDIR%%/qt3d/qt3dextras-module.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconegeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconegeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconegeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconegeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconemesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qconemesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidgeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidgeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidgeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidgeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidmesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcuboidmesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindergeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindergeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindergeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindergeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindermesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qcylindermesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusemapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusemapmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusemapmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusemapmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusespecularmapmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qdiffusespecularmapmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qfirstpersoncameracontroller.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qfirstpersoncameracontrollerprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qfirstpersoncameracontrollerprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qforwardrenderer-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qforwardrenderer.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qforwardrendererprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qforwardrendererprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qgoochmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qgoochmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qgoochmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qgoochmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapalphamaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapalphamaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusemapmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusespecularmapmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qnormaldiffusespecularmapmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qorbitcameracontroller-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qorbitcameracontroller.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qorbitcameracontrollerprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qorbitcameracontrollerprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qpervertexcolormaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qpervertexcolormaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qpervertexcolormaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qpervertexcolormaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongalphamaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongalphamaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongalphamaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongalphamaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongmaterial.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qphongmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanegeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanegeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanegeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanegeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanemesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qplanemesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qskyboxentity-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qskyboxentity.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qskyboxentityprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qskyboxentityprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheregeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheregeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheregeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheregeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheremesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qspheremesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qt3dwindow-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qt3dwindow.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusgeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusgeometry.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusgeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusgeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusmesh-members.html
%%QT_DOCDIR%%/qt3d/qt3dextras-qtorusmesh.html
%%QT_DOCDIR%%/qt3d/qt3dextras.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-abstractactioninput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-abstractactioninput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-abstractaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-abstractaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-action-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-action.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actioninput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actioninput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actioninputmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actioninputmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actionmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-actionmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-analogaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-analogaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-analogaxisinputmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-analogaxisinputmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-assignkeyboardfocusjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-assignkeyboardfocusjob.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axis-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axis.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axisidfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axisidfilter.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axisidsetting-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axisidsetting.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axismanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axismanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axissetting-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axissetting.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axissettingmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-axissettingmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-buttonaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-buttonaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-buttonaxisinputmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-buttonaxisinputmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-eventsourcesetterhelper-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-eventsourcesetterhelper.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendfunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendnode-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendnode.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendnodemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-genericdevicebackendnodemanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputchord-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputchord.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputchordmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputchordmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputhandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputhandler.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputnodefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputnodefunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsequence-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsequence.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsequencemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsequencemanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsettings-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsettings.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsettingsfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-inputsettingsfunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-jobtypes.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevicefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevicefunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevicemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboarddevicemanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardeventfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardeventfilter.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardhandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardhandler.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardhandlerfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardhandlerfunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardinputmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardinputmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardmousegenericdeviceintegration-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyboardmousegenericdeviceintegration.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyeventdispatcherjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-keyeventdispatcherjob.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevicemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevicemanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevicenodefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-logicaldevicenodefunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevicefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevicefunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevicemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousedevicemanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseeventdispatcherjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseeventdispatcherjob.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseeventfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseeventfilter.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousehandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousehandler.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousehandlerfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mousehandlerfunctor.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseinputmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-mouseinputmanager.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-movingaverage-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-movingaverage.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-updateaxisactionjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input-updateaxisactionjob.html
%%QT_DOCDIR%%/qt3d/qt3dinput-input.html
%%QT_DOCDIR%%/qt3d/qt3dinput-module.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractactioninput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractactioninput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractactioninputprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractactioninputprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinputdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinputdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinputprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractaxisinputprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevicebackendnode-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevicebackendnode.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevicebackendnodeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldevicebackendnodeprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldeviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qabstractphysicaldeviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaction-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaction.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactiondata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactiondata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactioninput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactioninput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactioninputdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qactioninputdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinputdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinputdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinputprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qanalogaxisinputprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxis-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxis.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxisdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxisdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxisprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxisprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissetting-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissetting.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissettingdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissettingdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissettingprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qaxissettingprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinputdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinputdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinputprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qbuttonaxisinputprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qgamepadinput-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qgamepadinput.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qgenericinputdevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qgenericinputdevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputaspect-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputaspect.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputaspectprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputaspectprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputchord-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputchord.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputchorddata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputchorddata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegration-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegration.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegrationfactory-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegrationfactory.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegrationprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceintegrationprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceplugin-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputdeviceplugin.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsequence-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsequence.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsequencedata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsequencedata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettings-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettings.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettingsdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettingsdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettingsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qinputsettingsprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboarddevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboarddevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboarddeviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboarddeviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandler.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandlerdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandlerdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandlerprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyboardhandlerprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyevent-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qkeyevent.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qlogicaldevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qlogicaldevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qlogicaldevicedata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qlogicaldevicedata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedevice-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedevice.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedevicedata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedevicedata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedeviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousedeviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmouseevent-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmouseevent.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandler-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandler.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandlerdata-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandlerdata.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandlerprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qmousehandlerprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchange.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchangebaseprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qphysicaldevicecreatedchangebaseprivate.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qwheelevent-members.html
%%QT_DOCDIR%%/qt3d/qt3dinput-qwheelevent.html
%%QT_DOCDIR%%/qt3d/qt3dinput.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-callbackjob-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-callbackjob.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-executor-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-executor.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-frameupdateevent-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-frameupdateevent.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handler-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handler.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handlerfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handlerfunctor.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handlermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-handlermanager.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-jobtypes.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-manager-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic-manager.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-logic.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-module.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qframeaction-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qframeaction.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qframeactionprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qframeactionprivate.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qlogicaspect-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qlogicaspect.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qlogicaspectprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3dlogic-qlogicaspectprivate.html
%%QT_DOCDIR%%/qt3d/qt3dlogic.html
%%QT_DOCDIR%%/qt3d/qt3drender-assimphelper.html
%%QT_DOCDIR%%/qt3d/qt3drender-assimpio-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-assimpio.html
%%QT_DOCDIR%%/qt3d/qt3drender-faceindices-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-faceindices.html
%%QT_DOCDIR%%/qt3d/qt3drender-framegraph.html
%%QT_DOCDIR%%/qt3d/qt3drender-functortype-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-functortype.html
%%QT_DOCDIR%%/qt3d/qt3drender-geometry.html
%%QT_DOCDIR%%/qt3d/qt3drender-gltfio-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-gltfio.html
%%QT_DOCDIR%%/qt3d/qt3drender-graphicsapifilterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-graphicsapifilterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-module.html
%%QT_DOCDIR%%/qt3d/qt3drender-propertyreaderinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-propertyreaderinterface.html
%%QT_DOCDIR%%/qt3d/qt3drender-protips.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractcollisionqueryservice-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractcollisionqueryservice.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractcollisionqueryserviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractcollisionqueryserviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlight-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlight.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlightdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlightdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlightprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstractlightprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttexture-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttexture.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttexturedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttexturedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimage-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimage.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimagedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimagedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimageprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureimageprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qabstracttextureprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphacoverage-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphacoverage.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatest.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatestdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatestdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatestprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qalphatestprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattribute-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattribute.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattributedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattributedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattributeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qattributeprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qaxisalignedboundingbox-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qaxisalignedboundingbox.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequation-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequation.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationarguments-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationarguments.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationargumentsdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationargumentsdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationargumentsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationargumentsprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qblendequationprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingsphere-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingsphere.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingvolume-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingvolume.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingvolumeprovider-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qboundingvolumeprovider.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbuffer.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferdatagenerator-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferdatagenerator.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qbufferprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcamera-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcamera.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralens-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralens.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralensdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralensdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralensprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameralensprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselectordata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselectordata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselectorprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcameraselectorprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffers-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffers.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffersdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffersdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffersprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclearbuffersprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplane-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplane.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplanedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplanedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplaneprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qclipplaneprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcollisionqueryresult-hit-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcollisionqueryresult-hit.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcollisionqueryresult-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcollisionqueryresult.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormask.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormaskdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormaskdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormaskprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcolormaskprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommand-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommand.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommanddata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommanddata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommandprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcomputecommandprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullface.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullfacedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullfacedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullfaceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qcullfaceprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtest.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtestdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtestdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtestprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdepthtestprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdirectionallight-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdirectionallight.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdirectionallightprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdirectionallightprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcompute-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcompute.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcomputedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcomputedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcomputeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdispatchcomputeprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdithering-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qdithering.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffect-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffect.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffectdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffectdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffectprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qeffectprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkey-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkey.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkeydata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkeydata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkeyprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfilterkeyprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qframegraphnode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qframegraphnode.html
%%QT_DOCDIR%%/qt3d/qt3drender-qframegraphnodeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qframegraphnodeprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontface.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontfacedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontfacedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontfaceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrontfaceprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrustumculling-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qfrustumculling.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometry-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometry.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometrydata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometrydata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryfactory-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryfactory.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrenderer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrenderer.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrendererdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrendererdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrendererprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgeometryrendererprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgraphicsapifilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgraphicsapifilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgraphicsapifilterprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qgraphicsapifilterprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qimagetexturedatafunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qimagetexturedatafunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-qitemmodelbuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qitemmodelbuffer.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayer.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilterprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerfilterprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qlayerprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterial-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterial.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterialdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterialdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterialprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmaterialprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmesh-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmesh.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmeshprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmeshprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmultisampleantialiasing-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qmultisampleantialiasing.html
%%QT_DOCDIR%%/qt3d/qt3drender-qnodepthmask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qnodepthmask.html
%%QT_DOCDIR%%/qt3d/qt3drender-qnodraw-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qnodraw.html
%%QT_DOCDIR%%/qt3d/qt3drender-qobjectpicker-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qobjectpicker.html
%%QT_DOCDIR%%/qt3d/qt3drender-qobjectpickerdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qobjectpickerdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameter.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameterprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qparameterprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickevent-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickevent.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickeventprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickeventprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickingsettings-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickingsettings.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickingsettingsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpickingsettingsprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpicktriangleevent-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpicktriangleevent.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointlight-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointlight.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointlightprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointlightprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsize-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsize.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsizedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsizedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsizeprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpointsizeprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffset-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffset.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffsetdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffsetdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffsetprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qpolygonoffsetprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qray3d-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qray3d.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingservice-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingservice.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingserviceprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingserviceprivate-query-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingserviceprivate-query.html
%%QT_DOCDIR%%/qt3d/qt3drender-qraycastingserviceprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderaspect-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderaspect.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderaspectprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderaspectprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpass-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpass.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilterprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassfilterprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderpassprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettings-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettings.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettingsdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettingsdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettingsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersettingsprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatecreatedchange-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatecreatedchange.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatecreatedchangebase-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatecreatedchangebase.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstateprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstateprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstateset-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstateset.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatesetdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatesetdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatesetprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrenderstatesetprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselectordata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselectordata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselectorprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendersurfaceselectorprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertarget-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertarget.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutput-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutput.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutputdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutputdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutputprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetoutputprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselectordata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselectordata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselectorprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qrendertargetselectorprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneiofactory-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneiofactory.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneiohandler-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneiohandler.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneioplugin-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneioplugin.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloader-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloader.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloaderdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloaderdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloaderprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsceneloaderprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortest.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortestdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortestdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortestprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qscissortestprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qseamlesscubemap-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qseamlesscubemap.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderdatadata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderdataprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderdataprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogram-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogram.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogramdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogramdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogramprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qshaderprogramprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortcriterion-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortcriterion.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicy.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicydata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicydata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicyprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qsortpolicyprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qspotlight-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qspotlight.html
%%QT_DOCDIR%%/qt3d/qt3drender-qspotlightprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qspotlightprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmask.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmaskdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmaskdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmaskprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstencilmaskprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperation-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperation.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationarguments-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationarguments.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationargumentsdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationargumentsdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationargumentsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationargumentsprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciloperationprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltest.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestarguments-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestarguments.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestargumentsdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestargumentsdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestargumentsprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestargumentsprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qstenciltestprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechnique-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechnique.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilterprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniquefilterprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniqueprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtechniqueprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture1d-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture1d.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture1darray-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture1darray.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2d-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2d.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2darray-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2darray.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2dmultisample-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2dmultisample.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture2dmultisamplearray.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture3d-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexture3d.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturebuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturebuffer.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturecubemap-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturecubemap.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturecubemaparray-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturecubemaparray.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturefromsourcegenerator-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturefromsourcegenerator.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturegenerator-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturegenerator.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimage-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimage.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedatagenerator-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedatagenerator.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedataprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimagedataprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimageprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureimageprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureloader-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureloader.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureloaderprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtextureloaderprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturerectangle-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturerectangle.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturewrapmode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qtexturewrapmode.html
%%QT_DOCDIR%%/qt3d/qt3drender-qurlhelper-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qurlhelper.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewport-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewport.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewportdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewportdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewportprivate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-qviewportprivate.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-abstractrenderer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-abstractrenderer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-alphacoverage-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-alphacoverage.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-alphafunc-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-alphafunc.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachment-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachment.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachmentmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachmentmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachmentpack-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attachmentpack.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attribute-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attribute.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attributemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-attributemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-backendnode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-backendnode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blendequation-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blendequation.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blendequationarguments-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blendequationarguments.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blocktoubo-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-blocktoubo.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-buffer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-buffer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-bufferfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-bufferfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-buffermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-buffermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-calcgeometrytrianglevolumes-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-calcgeometrytrianglevolumes.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-calculateboundingvolumejob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-calculateboundingvolumejob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameralens-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameralens.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameramanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameramanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameraselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cameraselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clearbufferinfo-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clearbufferinfo.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clearbuffers-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clearbuffers.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clipplane-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-clipplane.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-colormask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-colormask.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-computecommand-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-computecommand.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-computecommandmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-computecommandmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cullface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-cullface.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-depthtest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-depthtest.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-dispatchcompute-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-dispatchcompute.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-dithering-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-dithering.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-effect-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-effect.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-effectmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-effectmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-entity-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-entity.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-entitymanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-entitymanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-expandboundingvolumejob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-expandboundingvolumejob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterentitybycomponentjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterentitybycomponentjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterkey-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterkey.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterkeymanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterkeymanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterlayerentityjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-filterlayerentityjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framecleanupjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framecleanupjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphnode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphnode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphnodefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphnodefunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphvisitor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framegraphvisitor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framepreparationjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-framepreparationjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frontface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frontface.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frustumculling-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frustumculling.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frustumcullingjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-frustumcullingjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-genericlambdajob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-genericlambdajob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-genericstate-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-genericstate.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometry-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometry.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometrymanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometrymanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrenderer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrenderer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrendererfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrendererfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrenderermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-geometryrenderermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-glbuffer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-glbuffer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-glbuffermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-glbuffermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicscontext-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicscontext.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperes2-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperes2.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperes3-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperes3.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl2-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl2.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl3-3-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl3-3.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl3-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl3.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl4-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelpergl4.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperinterface-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-graphicshelperinterface.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-jobtypes.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layerfilternode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layerfilternode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-layermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-light-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-light.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightgatherer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightgatherer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightsource-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-lightsource.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadbufferjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadbufferjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadgeometryjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadgeometryjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadscenejob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadscenejob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadtexturedatajob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-loadtexturedatajob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-material-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-material.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-materialmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-materialmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-materialparametergathererjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-materialparametergathererjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-matrixmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-matrixmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-msaaenabled-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-msaaenabled.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodefunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodemanagers-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodemanagers.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodepthmask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodepthmask.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodraw-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-nodraw.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-objectpicker-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-objectpicker.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-objectpickermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-objectpickermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-openglvertexarrayobject-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-openglvertexarrayobject.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameter.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameterinfo-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameterinfo.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parametermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parametermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameterpack-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-parameterpack.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pickboundingvolumejob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pickboundingvolumejob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pickeventfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pickeventfilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-plane-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-plane.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-platformsurfacefilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-platformsurfacefilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pointsize-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-pointsize.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-polygonoffset-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-polygonoffset.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-quniformvalue-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-quniformvalue-textureidunit-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-quniformvalue-textureidunit.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-quniformvalue.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendercommand-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendercommand-sortingtype-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendercommand-sortingtype.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendercommand.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderconfiguration-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderconfiguration.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderentityfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderentityfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderer-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderer-viewsubmissionresultdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderer-viewsubmissionresultdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderer.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderlightfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderlightfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpass-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpass.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassfilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassfilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassparameterdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderpassparameterdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderqueue-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderqueue.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderscenefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderscenefunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersettings-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersettings.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersettingsfunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersettingsfunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendershaderdatafunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendershaderdatafunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstateimpl-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstateimpl.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstatemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstatemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstatenode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstatenode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstateset-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderstateset.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersurfaceselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendersurfaceselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertarget-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertarget.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetoutput-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetoutput.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetselector-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-rendertargetselector.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderthread-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderthread.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderview-innerdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderview-innerdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderview-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderview.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderviewbuilderjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderviewbuilderjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderviewinitializerjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-renderviewinitializerjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scene-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scene.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scenemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scenemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scissortest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-scissortest.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-seamlesscubemap-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-seamlesscubemap.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shader-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shader.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderattribute-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderattribute.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shadercache-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shadercache.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderdata-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderdata.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderdatamanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderdatamanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shadermanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shadermanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderparameterpack-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderparameterpack-namedtexture-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderparameterpack-namedtexture.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-shaderparameterpack.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-sortpolicy-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-sortpolicy.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-sphere-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-sphere.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statesetnode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statesetnode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statevariant-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statevariant-u-data-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statevariant-u-data.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-statevariant.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stencilmask-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stencilmask.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stencilop-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stencilop.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stenciltest-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stenciltest.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stringtoint-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-stringtoint.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-surfacelocker-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-surfacelocker.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-technique-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-technique.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-techniquefilter-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-techniquefilter.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-techniquemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-techniquemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texture-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texture.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturedatamanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturedatamanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturefunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimage-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimage.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimagefunctor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimagefunctor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimagemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-textureimagemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturemanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-texturemanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-transform-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-transform.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-transformmanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-transformmanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-triangleboundingvolume-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-triangleboundingvolume.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-trianglesextractor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-trianglesextractor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-trianglesvisitor-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-trianglesvisitor.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-uniformblockvaluebuilder-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-uniformblockvaluebuilder.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-updateworldboundingvolumejob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-updateworldboundingvolumejob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-updateworldtransformjob-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-updateworldtransformjob.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-vaomanager-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-vaomanager.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-viewportnode-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-viewportnode.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-vsyncframeadvanceservice-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-render-vsyncframeadvanceservice.html
%%QT_DOCDIR%%/qt3d/qt3drender-render.html
%%QT_DOCDIR%%/qt3d/qt3drender-textureloadinghelper-members.html
%%QT_DOCDIR%%/qt3d/qt3drender-textureloadinghelper.html
%%QT_DOCDIR%%/qt3d/qt3drender.html
%%QT_DOCDIR%%/qt3d/style/offline-simple.css
%%QT_DOCDIR%%/qt3d/style/offline.css
%%QT_DOCDIR%%/qtandroidextras.qch
%%QT_DOCDIR%%/qtandroidextras/examples-manifest.xml
%%QT_DOCDIR%%/qtandroidextras/examples-qtandroidextras.html
%%QT_DOCDIR%%/qtandroidextras/images/arrow_bc.png
%%QT_DOCDIR%%/qtandroidextras/images/bgrContent.png
%%QT_DOCDIR%%/qtandroidextras/images/btn_next.png
%%QT_DOCDIR%%/qtandroidextras/images/btn_prev.png
%%QT_DOCDIR%%/qtandroidextras/images/bullet_dn.png
%%QT_DOCDIR%%/qtandroidextras/images/bullet_sq.png
%%QT_DOCDIR%%/qtandroidextras/images/home.png
%%QT_DOCDIR%%/qtandroidextras/images/ico_note.png
%%QT_DOCDIR%%/qtandroidextras/images/ico_note_attention.png
%%QT_DOCDIR%%/qtandroidextras/images/ico_out.png
%%QT_DOCDIR%%/qtandroidextras/images/logo.png
%%QT_DOCDIR%%/qtandroidextras/images/notification.png
%%QT_DOCDIR%%/qtandroidextras/images/used-in-examples/notification/images/happy.png
%%QT_DOCDIR%%/qtandroidextras/images/used-in-examples/notification/images/sad.png
%%QT_DOCDIR%%/qtandroidextras/qandroidactivityresultreceiver-members.html
%%QT_DOCDIR%%/qtandroidextras/qandroidactivityresultreceiver.html
%%QT_DOCDIR%%/qtandroidextras/qandroidjnienvironment-members.html
%%QT_DOCDIR%%/qtandroidextras/qandroidjnienvironment.html
%%QT_DOCDIR%%/qtandroidextras/qandroidjniobject-members.html
%%QT_DOCDIR%%/qtandroidextras/qandroidjniobject.html
%%QT_DOCDIR%%/qtandroidextras/qtandroid.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-index.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-module.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-android-sources-androidmanifest-xml.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-example.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-main-cpp.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-main-qrc.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-notification-pro.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-notificationclient-cpp.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-notificationclient-h.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras-notification-qml-main-qml.html
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras.index
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras.qhp
%%QT_DOCDIR%%/qtandroidextras/qtandroidextras.qhp.sha1
%%QT_DOCDIR%%/qtandroidextras/style/offline-simple.css
%%QT_DOCDIR%%/qtandroidextras/style/offline.css
%%QT_DOCDIR%%/qtassistant.qch
%%QT_DOCDIR%%/qtassistant/assistant-custom-help-viewer.html
%%QT_DOCDIR%%/qtassistant/assistant-details.html
%%QT_DOCDIR%%/qtassistant/assistant-quick-guide.html
%%QT_DOCDIR%%/qtassistant/examples-manifest.xml
%%QT_DOCDIR%%/qtassistant/examples-qtassistant.html
%%QT_DOCDIR%%/qtassistant/images/arrow_bc.png
%%QT_DOCDIR%%/qtassistant/images/assistant-assistant.png
%%QT_DOCDIR%%/qtassistant/images/assistant-bookmarks.png
%%QT_DOCDIR%%/qtassistant/images/assistant-dockwidgets.png
%%QT_DOCDIR%%/qtassistant/images/assistant-examples.png
%%QT_DOCDIR%%/qtassistant/images/assistant-index.png
%%QT_DOCDIR%%/qtassistant/images/assistant-preferences-documentation.png
%%QT_DOCDIR%%/qtassistant/images/assistant-preferences-filters.png
%%QT_DOCDIR%%/qtassistant/images/assistant-preferences-fonts.png
%%QT_DOCDIR%%/qtassistant/images/assistant-preferences-options.png
%%QT_DOCDIR%%/qtassistant/images/assistant-search.png
%%QT_DOCDIR%%/qtassistant/images/bgrContent.png
%%QT_DOCDIR%%/qtassistant/images/btn_next.png
%%QT_DOCDIR%%/qtassistant/images/btn_prev.png
%%QT_DOCDIR%%/qtassistant/images/bullet_dn.png
%%QT_DOCDIR%%/qtassistant/images/bullet_sq.png
%%QT_DOCDIR%%/qtassistant/images/home.png
%%QT_DOCDIR%%/qtassistant/images/ico_note.png
%%QT_DOCDIR%%/qtassistant/images/ico_note_attention.png
%%QT_DOCDIR%%/qtassistant/images/ico_out.png
%%QT_DOCDIR%%/qtassistant/images/logo.png
%%QT_DOCDIR%%/qtassistant/images/simpletextviewer-example.png
%%QT_DOCDIR%%/qtassistant/images/simpletextviewer-findfiledialog.png
%%QT_DOCDIR%%/qtassistant/images/simpletextviewer-mainwindow.png
%%QT_DOCDIR%%/qtassistant/qtassistant-index.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-example.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-main-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-remotecontrol-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-remotecontrol-h.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-remotecontrol-pro.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-remotecontrol-qrc.html
%%QT_DOCDIR%%/qtassistant/qtassistant-remotecontrol-remotecontrol-ui.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-assistant-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-assistant-h.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-example.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-findfiledialog-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-findfiledialog-h.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-main-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-mainwindow-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-mainwindow-h.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-simpletextviewer-pro.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-textedit-cpp.html
%%QT_DOCDIR%%/qtassistant/qtassistant-simpletextviewer-textedit-h.html
%%QT_DOCDIR%%/qtassistant/qtassistant.index
%%QT_DOCDIR%%/qtassistant/qtassistant.qhp
%%QT_DOCDIR%%/qtassistant/qtassistant.qhp.sha1
%%QT_DOCDIR%%/qtassistant/style/offline-simple.css
%%QT_DOCDIR%%/qtassistant/style/offline.css
%%QT_DOCDIR%%/qtbluetooth.qch
%%QT_DOCDIR%%/qtbluetooth/bluetooth-examples.html
%%QT_DOCDIR%%/qtbluetooth/examples-manifest.xml
%%QT_DOCDIR%%/qtbluetooth/images/arrow_bc.png
%%QT_DOCDIR%%/qtbluetooth/images/bgrContent.png
%%QT_DOCDIR%%/qtbluetooth/images/btchat-example.png
%%QT_DOCDIR%%/qtbluetooth/images/btfiletransfer-example.png
%%QT_DOCDIR%%/qtbluetooth/images/btn_next.png
%%QT_DOCDIR%%/qtbluetooth/images/btn_prev.png
%%QT_DOCDIR%%/qtbluetooth/images/btscanner-example.png
%%QT_DOCDIR%%/qtbluetooth/images/bullet_dn.png
%%QT_DOCDIR%%/qtbluetooth/images/bullet_sq.png
%%QT_DOCDIR%%/qtbluetooth/images/chat-view.png
%%QT_DOCDIR%%/qtbluetooth/images/devicescan.png
%%QT_DOCDIR%%/qtbluetooth/images/heartratefound.png
%%QT_DOCDIR%%/qtbluetooth/images/heartratemonitor.png
%%QT_DOCDIR%%/qtbluetooth/images/heartrateresults.png
%%QT_DOCDIR%%/qtbluetooth/images/home.png
%%QT_DOCDIR%%/qtbluetooth/images/ico_note.png
%%QT_DOCDIR%%/qtbluetooth/images/ico_note_attention.png
%%QT_DOCDIR%%/qtbluetooth/images/ico_out.png
%%QT_DOCDIR%%/qtbluetooth/images/intro.png
%%QT_DOCDIR%%/qtbluetooth/images/intro1.png
%%QT_DOCDIR%%/qtbluetooth/images/logo.png
%%QT_DOCDIR%%/qtbluetooth/images/lowenergyscanner-chars.png
%%QT_DOCDIR%%/qtbluetooth/images/lowenergyscanner-devices.png
%%QT_DOCDIR%%/qtbluetooth/images/lowenergyscanner-services.png
%%QT_DOCDIR%%/qtbluetooth/images/opp-example-1.png
%%QT_DOCDIR%%/qtbluetooth/images/opp-example-2.png
%%QT_DOCDIR%%/qtbluetooth/images/opp-example-3.png
%%QT_DOCDIR%%/qtbluetooth/images/peripheral-structure.png
%%QT_DOCDIR%%/qtbluetooth/images/servicescan.png
%%QT_DOCDIR%%/qtbluetooth/images/used-in-examples/chat/images/clear.png
%%QT_DOCDIR%%/qtbluetooth/images/used-in-examples/chat/images/default.png
%%QT_DOCDIR%%/qtbluetooth/images/used-in-examples/chat/images/lineedit-bg.png
%%QT_DOCDIR%%/qtbluetooth/qbluetooth.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothaddress-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothaddress.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothdevicediscoveryagent.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothdeviceinfo-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothdeviceinfo.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothhostinfo-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothhostinfo.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothlocaldevice-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothlocaldevice.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserver-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserver.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothservicediscoveryagent-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothservicediscoveryagent.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo-alternative.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo-sequence.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothserviceinfo.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothsocket-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothsocket.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransfermanager-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransfermanager.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransferreply-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransferreply.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransferrequest-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothtransferrequest.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothuuid-members.html
%%QT_DOCDIR%%/qtbluetooth/qbluetoothuuid.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingdata-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingdata.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingparameters-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyadvertisingparameters.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycharacteristic-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycharacteristic.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycharacteristicdata-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycharacteristicdata.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyconnectionparameters-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyconnectionparameters.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycontroller-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycontroller-obsolete.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergycontroller.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergydescriptor-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergydescriptor.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergydescriptordata-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergydescriptordata.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyservice-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyservice.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyservicedata-members.html
%%QT_DOCDIR%%/qtbluetooth/qlowenergyservicedata.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
%%QT_DOCDIR%%/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-btchat-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chat-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chat-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chat-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chatclient-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chatclient-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chatserver-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-chatserver-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-remoteselector-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-remoteselector-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btchat-remoteselector-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-progress-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-progress-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-progress-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-btscanner-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-device-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-device-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-device-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-service-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-service-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-btscanner-service-ui.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-button-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-chat-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-chat-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-chat-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-inputbox-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-qmlchat-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-chat-search-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-button-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-dialog-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-draw-js.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-home-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-main-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-monitor-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-point-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-assets-results-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-deviceinfo-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-deviceinfo-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-heartlistener-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-heartrate-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-heartrate-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartlistener-resources-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartrate-server-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartrate-server-heartrate-server-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-heartrate-server-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-index.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-le-overview.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-dialog-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-header-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-label-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-main-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-menu-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-assets-services-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-device-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-device-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-resources-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-module.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-overview.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-bttransfer-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-button-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-devicediscovery-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-filesending-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-pictureselector-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-picturetransfer-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-picturetransfer-qmltransfer-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-assets-board-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-assets-dialog-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-assets-main-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-assets-menu-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-main-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-pingpong-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-pingpong-h.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-pingpong-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-pingpong-resource-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-qmlmodule.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-button-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-example.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-qmlscanner-cpp.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-scanner-pro.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-scanner-qml.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth-scanner-scanner-qrc.html
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth.index
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth.qhp
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth.qhp.sha1
%%QT_DOCDIR%%/qtbluetooth/qtbluetooth.tags
%%QT_DOCDIR%%/qtbluetooth/style/offline-simple.css
%%QT_DOCDIR%%/qtbluetooth/style/offline.css
%%QT_DOCDIR%%/qtcanvas3d.qch
%%QT_DOCDIR%%/qtcanvas3d/examples-manifest.xml
%%QT_DOCDIR%%/qtcanvas3d/images/arrow_bc.png
%%QT_DOCDIR%%/qtcanvas3d/images/bgrContent.png
%%QT_DOCDIR%%/qtcanvas3d/images/btn_next.png
%%QT_DOCDIR%%/qtcanvas3d/images/btn_prev.png
%%QT_DOCDIR%%/qtcanvas3d/images/bullet_dn.png
%%QT_DOCDIR%%/qtcanvas3d/images/bullet_sq.png
%%QT_DOCDIR%%/qtcanvas3d/images/cellphone-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/framebuffer-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/home.png
%%QT_DOCDIR%%/qtcanvas3d/images/ico_note.png
%%QT_DOCDIR%%/qtcanvas3d/images/ico_note_attention.png
%%QT_DOCDIR%%/qtcanvas3d/images/ico_out.png
%%QT_DOCDIR%%/qtcanvas3d/images/interaction-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/jsonmodels-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/logo.png
%%QT_DOCDIR%%/qtcanvas3d/images/oneqt-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/planets-example.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/quickitemtexture-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/textureandlight-example.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/calendar.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/camera.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/clock.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/contacts.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/gallery.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/games.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/lock.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/mail.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/maps.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/menu_background.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/music.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/plutomap1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/qtlogo_with_alpha.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/settings.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/todo.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/videos.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/earth.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthbump1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthcloudmapcolortrans.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthmap1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthspec1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/galaxy_starfield.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupiter.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupitermap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/mars.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsbump1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsmap1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercury.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurybump.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurymap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonbump1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonmap1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptune.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptunemap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutobump1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutomap1k.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturn.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnmap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnringcolortrans.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/sun.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/sunmap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranus.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusmap.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusringcolortrans.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/venus.png
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusbump.jpg
%%QT_DOCDIR%%/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusmap.jpg
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3d-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3d.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dshader-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dshader.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-context3d-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-context3d.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-glstatedumpext-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-glstatedumpext.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-textureimage-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-textureimage.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-textureimagefactory-members.html
%%QT_DOCDIR%%/qtcanvas3d/qml-qtcanvas3d-textureimagefactory.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-conformance-issues-html.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-examples.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-getting-started.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-index.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-interaction-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-interaction-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-interaction-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-main-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-jsonmodels-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-jsonmodels-qml-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-logging.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-qmlmodule.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-infosheet-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-navibutton-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-oneqt-swipearea-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-example.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-fpsdisplay-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-infosheet-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-main-cpp.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-planetbutton-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-planets-js.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-planets-pro.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qrc.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d-threejs-planets-styledslider-qml.html
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d.index
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d.qhp
%%QT_DOCDIR%%/qtcanvas3d/qtcanvas3d.qhp.sha1
%%QT_DOCDIR%%/qtcanvas3d/style/offline-simple.css
%%QT_DOCDIR%%/qtcanvas3d/style/offline.css
%%QT_DOCDIR%%/qtcharts.qch
%%QT_DOCDIR%%/qtcharts/charts-examples.html
%%QT_DOCDIR%%/qtcharts/examples-manifest.xml
%%QT_DOCDIR%%/qtcharts/images/api_category_axis.png
%%QT_DOCDIR%%/qtcharts/images/api_datatime_axis.png
%%QT_DOCDIR%%/qtcharts/images/arrow_bc.png
%%QT_DOCDIR%%/qtcharts/images/bgrContent.png
%%QT_DOCDIR%%/qtcharts/images/btn_next.png
%%QT_DOCDIR%%/qtcharts/images/btn_prev.png
%%QT_DOCDIR%%/qtcharts/images/bullet_dn.png
%%QT_DOCDIR%%/qtcharts/images/bullet_sq.png
%%QT_DOCDIR%%/qtcharts/images/examples_areachart.png
%%QT_DOCDIR%%/qtcharts/images/examples_audio.png
%%QT_DOCDIR%%/qtcharts/images/examples_barchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_barmodelmapper.png
%%QT_DOCDIR%%/qtcharts/images/examples_boxplotchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_callout.png
%%QT_DOCDIR%%/qtcharts/images/examples_chartthemes_blue_cerulean.png
%%QT_DOCDIR%%/qtcharts/images/examples_chartthemes_brown_sand.png
%%QT_DOCDIR%%/qtcharts/images/examples_chartthemes_light.png
%%QT_DOCDIR%%/qtcharts/images/examples_customchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_datetimeaxis.png
%%QT_DOCDIR%%/qtcharts/images/examples_donutbreakdown.png
%%QT_DOCDIR%%/qtcharts/images/examples_donutchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_dynamicspline1.png
%%QT_DOCDIR%%/qtcharts/images/examples_dynamicspline2.png
%%QT_DOCDIR%%/qtcharts/images/examples_horizontalbarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_horizontalpercentbarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_horizontalstackedbarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_legend_detach.png
%%QT_DOCDIR%%/qtcharts/images/examples_legend_detach2.png
%%QT_DOCDIR%%/qtcharts/images/examples_legendmarkers.png
%%QT_DOCDIR%%/qtcharts/images/examples_lineandbar.png
%%QT_DOCDIR%%/qtcharts/images/examples_linechart.png
%%QT_DOCDIR%%/qtcharts/images/examples_logvalueaxis.png
%%QT_DOCDIR%%/qtcharts/images/examples_modeldata.png
%%QT_DOCDIR%%/qtcharts/images/examples_multiaxis.png
%%QT_DOCDIR%%/qtcharts/images/examples_nesteddonuts.png
%%QT_DOCDIR%%/qtcharts/images/examples_openglseries.png
%%QT_DOCDIR%%/qtcharts/images/examples_percentbarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_percentbarchart_legend.png
%%QT_DOCDIR%%/qtcharts/images/examples_piechart.png
%%QT_DOCDIR%%/qtcharts/images/examples_piechartdrill1.png
%%QT_DOCDIR%%/qtcharts/images/examples_piechartdrill2.png
%%QT_DOCDIR%%/qtcharts/images/examples_polarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlaxes1.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlaxes2.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlaxes3.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlboxplot.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart1.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart10.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart11.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart12.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart2.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart3.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart4.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart5.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart6.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart7.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart8.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlchart9.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlcustomizations.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlcustomlegend1.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlcustomlegend2.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlcustomlegend3.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlf1legends.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmloscilloscope.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlpiechart.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlpolarchart1.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlpolarchart2.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlpolarchart3.png
%%QT_DOCDIR%%/qtcharts/images/examples_qmlweather.png
%%QT_DOCDIR%%/qtcharts/images/examples_scatterchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_scatterinteractions.png
%%QT_DOCDIR%%/qtcharts/images/examples_splinechart.png
%%QT_DOCDIR%%/qtcharts/images/examples_stackedbarchart.png
%%QT_DOCDIR%%/qtcharts/images/examples_stackedbarchartdrilldown1.png
%%QT_DOCDIR%%/qtcharts/images/examples_stackedbarchartdrilldown2.png
%%QT_DOCDIR%%/qtcharts/images/examples_temperaturerecords.png
%%QT_DOCDIR%%/qtcharts/images/examples_zoomlinechart1.png
%%QT_DOCDIR%%/qtcharts/images/examples_zoomlinechart2.png
%%QT_DOCDIR%%/qtcharts/images/home.png
%%QT_DOCDIR%%/qtcharts/images/ico_note.png
%%QT_DOCDIR%%/qtcharts/images/ico_note_attention.png
%%QT_DOCDIR%%/qtcharts/images/ico_out.png
%%QT_DOCDIR%%/qtcharts/images/logo.png
%%QT_DOCDIR%%/qtcharts/images/piechart_customization.png
%%QT_DOCDIR%%/qtcharts/qabstractaxis-members.html
%%QT_DOCDIR%%/qtcharts/qabstractaxis.html
%%QT_DOCDIR%%/qtcharts/qabstractbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qabstractbarseries.html
%%QT_DOCDIR%%/qtcharts/qabstractseries-members.html
%%QT_DOCDIR%%/qtcharts/qabstractseries.html
%%QT_DOCDIR%%/qtcharts/qarealegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qarealegendmarker.html
%%QT_DOCDIR%%/qtcharts/qareaseries-members.html
%%QT_DOCDIR%%/qtcharts/qareaseries.html
%%QT_DOCDIR%%/qtcharts/qbarcategoryaxis-members.html
%%QT_DOCDIR%%/qtcharts/qbarcategoryaxis.html
%%QT_DOCDIR%%/qtcharts/qbarlegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qbarlegendmarker.html
%%QT_DOCDIR%%/qtcharts/qbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qbarseries.html
%%QT_DOCDIR%%/qtcharts/qbarset-members.html
%%QT_DOCDIR%%/qtcharts/qbarset.html
%%QT_DOCDIR%%/qtcharts/qboxplotlegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qboxplotlegendmarker.html
%%QT_DOCDIR%%/qtcharts/qboxplotseries-members.html
%%QT_DOCDIR%%/qtcharts/qboxplotseries.html
%%QT_DOCDIR%%/qtcharts/qboxset-members.html
%%QT_DOCDIR%%/qtcharts/qboxset.html
%%QT_DOCDIR%%/qtcharts/qcategoryaxis-members.html
%%QT_DOCDIR%%/qtcharts/qcategoryaxis.html
%%QT_DOCDIR%%/qtcharts/qchart-members.html
%%QT_DOCDIR%%/qtcharts/qchart.html
%%QT_DOCDIR%%/qtcharts/qchartview-members.html
%%QT_DOCDIR%%/qtcharts/qchartview.html
%%QT_DOCDIR%%/qtcharts/qdatetimeaxis-members.html
%%QT_DOCDIR%%/qtcharts/qdatetimeaxis.html
%%QT_DOCDIR%%/qtcharts/qhbarmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qhbarmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qhorizontalbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qhorizontalbarseries.html
%%QT_DOCDIR%%/qtcharts/qhorizontalpercentbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qhorizontalpercentbarseries.html
%%QT_DOCDIR%%/qtcharts/qhorizontalstackedbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qhorizontalstackedbarseries.html
%%QT_DOCDIR%%/qtcharts/qhpiemodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qhpiemodelmapper.html
%%QT_DOCDIR%%/qtcharts/qhxymodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qhxymodelmapper.html
%%QT_DOCDIR%%/qtcharts/qlegend-members.html
%%QT_DOCDIR%%/qtcharts/qlegend.html
%%QT_DOCDIR%%/qtcharts/qlegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qlegendmarker.html
%%QT_DOCDIR%%/qtcharts/qlineseries-members.html
%%QT_DOCDIR%%/qtcharts/qlineseries.html
%%QT_DOCDIR%%/qtcharts/qlogvalueaxis-members.html
%%QT_DOCDIR%%/qtcharts/qlogvalueaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-abstractseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-areaseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-areaseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barcategoryaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barcategoryaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barset-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-barset.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-boxplotseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-boxplotseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-boxset-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-boxset.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-categoryaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-categoryaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-categoryrange-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-categoryrange.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-chartview-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-chartview.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-datetimeaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-datetimeaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hbarmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hbarmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalpercentbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalpercentbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalstackedbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-horizontalstackedbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hpiemodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hpiemodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hxymodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-hxymodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-legend-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-legend.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-lineseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-lineseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-logvalueaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-logvalueaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-margins-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-margins.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-percentbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-percentbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-pieseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-pieseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-pieslice-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-pieslice.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-polarchartview-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-polarchartview.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-scatterseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-scatterseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-splineseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-splineseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-stackedbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-stackedbarseries.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-valueaxis-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-valueaxis.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vbarmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vbarmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vboxplotmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vboxplotmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vpiemodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vpiemodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vxymodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-vxymodelmapper.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-xypoint-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-xypoint.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-xyseries-members.html
%%QT_DOCDIR%%/qtcharts/qml-qtcharts-xyseries.html
%%QT_DOCDIR%%/qtcharts/qpercentbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qpercentbarseries.html
%%QT_DOCDIR%%/qtcharts/qpielegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qpielegendmarker.html
%%QT_DOCDIR%%/qtcharts/qpieseries-members.html
%%QT_DOCDIR%%/qtcharts/qpieseries.html
%%QT_DOCDIR%%/qtcharts/qpieslice-members.html
%%QT_DOCDIR%%/qtcharts/qpieslice.html
%%QT_DOCDIR%%/qtcharts/qpolarchart-members.html
%%QT_DOCDIR%%/qtcharts/qpolarchart.html
%%QT_DOCDIR%%/qtcharts/qscatterseries-members.html
%%QT_DOCDIR%%/qtcharts/qscatterseries.html
%%QT_DOCDIR%%/qtcharts/qsplineseries-members.html
%%QT_DOCDIR%%/qtcharts/qsplineseries.html
%%QT_DOCDIR%%/qtcharts/qstackedbarseries-members.html
%%QT_DOCDIR%%/qtcharts/qstackedbarseries.html
%%QT_DOCDIR%%/qtcharts/qt-charts-module.html
%%QT_DOCDIR%%/qtcharts/qtcharts-areachart-areachart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-areachart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-areachart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-audio-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-widget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-widget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-xyseriesiodevice-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-audio-xyseriesiodevice-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barchart-barchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-barmodelmapper-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-customtablemodel-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-customtablemodel-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-tablewidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-barmodelmapper-tablewidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-boxdatareader-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-boxdatareader-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-boxplotchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-boxplotdata-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-boxplotchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-callout-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-callout-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-callout-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-view-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-callout-view-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-chartthemes-chartthemes-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-chartthemes-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-chartthemes-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-chartthemes-themewidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-chartthemes-themewidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-customchart-customchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-customchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-customchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-datetimeaxis-datetimeaxis-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-datetimeaxis-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-datetimeaxis-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-datetimeaxis-sundata-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-donutbreakdown-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-donutbreakdownchart-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-donutbreakdownchart-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-mainslice-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutbreakdown-mainslice-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutchart-donutchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-donutchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-dynamicspline-chart-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-dynamicspline-chart-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-dynamicspline-dynamicspline-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-dynamicspline-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-dynamicspline-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalbarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalbarchart-horizontalbarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalbarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalpercentbarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalpercentbarchart-horizontalpercentbarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalpercentbarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalstackedbarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalstackedbarchart-horizontalstackedbarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-horizontalstackedbarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-index.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legend-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legend-legend-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legend-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legend-mainwidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legend-mainwidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legendmarkers-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legendmarkers-legendmarkers-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legendmarkers-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legendmarkers-mainwidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-legendmarkers-mainwidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-lineandbar-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-lineandbar-lineandbar-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-lineandbar-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-linechart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-linechart-linechart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-linechart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-logvalueaxis-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-logvalueaxis-logvalueaxis-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-logvalueaxis-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-customtablemodel-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-customtablemodel-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-modeldata-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-tablewidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-modeldata-tablewidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-multiaxis-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-multiaxis-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-multiaxis-multiaxis-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-nesteddonuts-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-nesteddonuts-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-nesteddonuts-nesteddonuts-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-nesteddonuts-widget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-nesteddonuts-widget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-openglseries-datasource-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-openglseries-datasource-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-openglseries-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-openglseries-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-openglseries-openglseries-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-percentbarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-percentbarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-percentbarchart-percentbarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechart-piechart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-brushtool-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-brushtool-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-customslice-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-customslice-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-mainwidget-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-mainwidget-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-pentool-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-pentool-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartcustomization-piechartcustomization-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-drilldownchart-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-drilldownchart-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-drilldownslice-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-drilldownslice-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-piechartdrilldown-piechartdrilldown-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-polarchart-chartview-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-polarchart-chartview-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-polarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-polarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-polarchart-polarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view1-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view2-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-qml-qmlaxes-view3-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-qmlaxes-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlaxes-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view1-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view10-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view11-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view12-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view2-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view3-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view4-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view5-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view6-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view7-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view8-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qml-qmlchart-view9-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-qmlchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlchart-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomizations-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomizations-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomizations-qml-qmlcustomizations-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomizations-qmlcustomizations-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomizations-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-animatedareaseries-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewhighlighted-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewselector-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewstacked-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-customlegend-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qml-qmlcustomlegend-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-qmlcustomlegend-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlcustomlegend-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-qml-qmlf1legends-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-qml-qmlf1legends-speedsxml-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-qmlf1legends-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlf1legends-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlmodule.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-datasource-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-datasource-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-controlpanel-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-multibutton-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-qml-qmloscilloscope-scopeview-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-qmloscilloscope-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmloscilloscope-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view1-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view2-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-qml-qmlpolarchart-view3-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-qmlpolarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlpolarchart-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlweather-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlweather-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlweather-qml-qmlweather-main-qml.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlweather-qmlweather-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-qmlweather-resources-qrc.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterchart-chartview-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterchart-chartview-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterchart-scatterchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterinteractions-chartview-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterinteractions-chartview-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterinteractions-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterinteractions-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-scatterinteractions-scatterinteractions-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-splinechart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-splinechart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-splinechart-splinechart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchart-stackedbarchart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownchart-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownchart-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownseries-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-drilldownseries-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-stackedbarchartdrilldown-stackedbarchartdrilldown-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-temperaturerecords-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-temperaturerecords-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-temperaturerecords-temperaturerecords-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-chart-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-chart-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-chartview-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-chartview-h.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-example.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-main-cpp.html
%%QT_DOCDIR%%/qtcharts/qtcharts-zoomlinechart-zoomlinechart-pro.html
%%QT_DOCDIR%%/qtcharts/qtcharts.index
%%QT_DOCDIR%%/qtcharts/qtcharts.qhp
%%QT_DOCDIR%%/qtcharts/qtcharts.qhp.sha1
%%QT_DOCDIR%%/qtcharts/qvalueaxis-members.html
%%QT_DOCDIR%%/qtcharts/qvalueaxis.html
%%QT_DOCDIR%%/qtcharts/qvbarmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qvbarmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qvboxplotmodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qvboxplotmodelmapper.html
%%QT_DOCDIR%%/qtcharts/qvpiemodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qvpiemodelmapper.html
%%QT_DOCDIR%%/qtcharts/qvxymodelmapper-members.html
%%QT_DOCDIR%%/qtcharts/qvxymodelmapper.html
%%QT_DOCDIR%%/qtcharts/qxylegendmarker-members.html
%%QT_DOCDIR%%/qtcharts/qxylegendmarker.html
%%QT_DOCDIR%%/qtcharts/qxyseries-members.html
%%QT_DOCDIR%%/qtcharts/qxyseries.html
%%QT_DOCDIR%%/qtcharts/style/offline-simple.css
%%QT_DOCDIR%%/qtcharts/style/offline.css
%%QT_DOCDIR%%/qtconcurrent.qch
%%QT_DOCDIR%%/qtconcurrent/examples-manifest.xml
%%QT_DOCDIR%%/qtconcurrent/images/arrow_bc.png
%%QT_DOCDIR%%/qtconcurrent/images/bgrContent.png
%%QT_DOCDIR%%/qtconcurrent/images/btn_next.png
%%QT_DOCDIR%%/qtconcurrent/images/btn_prev.png
%%QT_DOCDIR%%/qtconcurrent/images/bullet_dn.png
%%QT_DOCDIR%%/qtconcurrent/images/bullet_sq.png
%%QT_DOCDIR%%/qtconcurrent/images/home.png
%%QT_DOCDIR%%/qtconcurrent/images/ico_note.png
%%QT_DOCDIR%%/qtconcurrent/images/ico_note_attention.png
%%QT_DOCDIR%%/qtconcurrent/images/ico_out.png
%%QT_DOCDIR%%/qtconcurrent/images/imagescaling_example.png
%%QT_DOCDIR%%/qtconcurrent/images/logo.png
%%QT_DOCDIR%%/qtconcurrent/images/qtconcurrent-progressdialog.png
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-imagescaling-example.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-imagescaling-imagescaling-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-imagescaling-imagescaling-h.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-imagescaling-imagescaling-pro.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-imagescaling-main-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-index.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-map-example.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-map-main-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-map-map-pro.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-module.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-obsolete.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-progressdialog-example.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-progressdialog-main-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-progressdialog-progressdialog-pro.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-runfunction-example.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-runfunction-main-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-runfunction-runfunction-pro.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-wordcount-example.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-wordcount-main-cpp.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent-wordcount-wordcount-pro.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent.index
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent.qhp
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent.qhp.sha1
%%QT_DOCDIR%%/qtconcurrent/qtconcurrent.tags
%%QT_DOCDIR%%/qtconcurrent/qtconcurrentfilter.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrentmap.html
%%QT_DOCDIR%%/qtconcurrent/qtconcurrentrun.html
%%QT_DOCDIR%%/qtconcurrent/style/offline-simple.css
%%QT_DOCDIR%%/qtconcurrent/style/offline.css
%%QT_DOCDIR%%/qtcore.qch
%%QT_DOCDIR%%/qtcore/animation-overview.html
%%QT_DOCDIR%%/qtcore/animation.html
%%QT_DOCDIR%%/qtcore/codec-big5.html
%%QT_DOCDIR%%/qtcore/codec-big5hkscs.html
%%QT_DOCDIR%%/qtcore/codec-eucjp.html
%%QT_DOCDIR%%/qtcore/codec-euckr.html
%%QT_DOCDIR%%/qtcore/codec-gbk.html
%%QT_DOCDIR%%/qtcore/codec-sjis.html
%%QT_DOCDIR%%/qtcore/codec-tscii.html
%%QT_DOCDIR%%/qtcore/codecs-jis.html
%%QT_DOCDIR%%/qtcore/containers.html
%%QT_DOCDIR%%/qtcore/custom-types.html
%%QT_DOCDIR%%/qtcore/datastreamformat.html
%%QT_DOCDIR%%/qtcore/events.html
%%QT_DOCDIR%%/qtcore/eventsandfilters.html
%%QT_DOCDIR%%/qtcore/examples-manifest.xml
%%QT_DOCDIR%%/qtcore/images/abstract-connections.png
%%QT_DOCDIR%%/qtcore/images/animations-architecture.png
%%QT_DOCDIR%%/qtcore/images/arrow_bc.png
%%QT_DOCDIR%%/qtcore/images/bgrContent.png
%%QT_DOCDIR%%/qtcore/images/brush-styles.png
%%QT_DOCDIR%%/qtcore/images/btn_next.png
%%QT_DOCDIR%%/qtcore/images/btn_prev.png
%%QT_DOCDIR%%/qtcore/images/bullet_dn.png
%%QT_DOCDIR%%/qtcore/images/bullet_sq.png
%%QT_DOCDIR%%/qtcore/images/cursor-arrow.png
%%QT_DOCDIR%%/qtcore/images/cursor-busy.png
%%QT_DOCDIR%%/qtcore/images/cursor-closedhand.png
%%QT_DOCDIR%%/qtcore/images/cursor-cross.png
%%QT_DOCDIR%%/qtcore/images/cursor-forbidden.png
%%QT_DOCDIR%%/qtcore/images/cursor-hand.png
%%QT_DOCDIR%%/qtcore/images/cursor-hsplit.png
%%QT_DOCDIR%%/qtcore/images/cursor-ibeam.png
%%QT_DOCDIR%%/qtcore/images/cursor-openhand.png
%%QT_DOCDIR%%/qtcore/images/cursor-sizeall.png
%%QT_DOCDIR%%/qtcore/images/cursor-sizeb.png
%%QT_DOCDIR%%/qtcore/images/cursor-sizef.png
%%QT_DOCDIR%%/qtcore/images/cursor-sizeh.png
%%QT_DOCDIR%%/qtcore/images/cursor-sizev.png
%%QT_DOCDIR%%/qtcore/images/cursor-uparrow.png
%%QT_DOCDIR%%/qtcore/images/cursor-vsplit.png
%%QT_DOCDIR%%/qtcore/images/cursor-wait.png
%%QT_DOCDIR%%/qtcore/images/cursor-whatsthis.png
%%QT_DOCDIR%%/qtcore/images/home.png
%%QT_DOCDIR%%/qtcore/images/ico_note.png
%%QT_DOCDIR%%/qtcore/images/ico_note_attention.png
%%QT_DOCDIR%%/qtcore/images/ico_out.png
%%QT_DOCDIR%%/qtcore/images/javaiterators1.png
%%QT_DOCDIR%%/qtcore/images/javaiterators2.png
%%QT_DOCDIR%%/qtcore/images/localfortuneclient-example.png
%%QT_DOCDIR%%/qtcore/images/localfortuneserver-example.png
%%QT_DOCDIR%%/qtcore/images/logo.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot-example.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_scroll1.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_scroll2.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_scroll3.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_zoom1.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_zoom2.png
%%QT_DOCDIR%%/qtcore/images/mandelbrot_zoom3.png
%%QT_DOCDIR%%/qtcore/images/mimetypebrowser.png
%%QT_DOCDIR%%/qtcore/images/modelindex-no-parent.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-append-columns.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-append-rows.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-insert-columns.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-insert-rows.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-remove-columns.png
%%QT_DOCDIR%%/qtcore/images/modelview-begin-remove-rows.png
%%QT_DOCDIR%%/qtcore/images/modelview-move-rows-1.png
%%QT_DOCDIR%%/qtcore/images/modelview-move-rows-2.png
%%QT_DOCDIR%%/qtcore/images/modelview-move-rows-3.png
%%QT_DOCDIR%%/qtcore/images/modelview-move-rows-4.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inback.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inbounce.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-incirc.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-incubic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inelastic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inexpo.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutback.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutbounce.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutcirc.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutcubic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutelastic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutexpo.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutquad.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutquart.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutquint.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inoutsine.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inquad.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inquart.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-inquint.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-insine.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-linear.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outback.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outbounce.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outcirc.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outcubic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outelastic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outexpo.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinback.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinbounce.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outincirc.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outincubic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinelastic.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinexpo.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinquad.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinquart.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinquint.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outinsine.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outquad.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outquart.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outquint.png
%%QT_DOCDIR%%/qtcore/images/qeasingcurve-outsine.png
%%QT_DOCDIR%%/qtcore/images/qimage-scaling.png
%%QT_DOCDIR%%/qtcore/images/qline-coordinates.png
%%QT_DOCDIR%%/qtcore/images/qline-point.png
%%QT_DOCDIR%%/qtcore/images/qlinef-angle-identicaldirection.png
%%QT_DOCDIR%%/qtcore/images/qlinef-angle-oppositedirection.png
%%QT_DOCDIR%%/qtcore/images/qlinef-bounded.png
%%QT_DOCDIR%%/qtcore/images/qlinef-normalvector.png
%%QT_DOCDIR%%/qtcore/images/qlinef-unbounded.png
%%QT_DOCDIR%%/qtcore/images/qpen-bevel.png
%%QT_DOCDIR%%/qtcore/images/qpen-custom.png
%%QT_DOCDIR%%/qtcore/images/qpen-dash.png
%%QT_DOCDIR%%/qtcore/images/qpen-dashdot.png
%%QT_DOCDIR%%/qtcore/images/qpen-dashdotdot.png
%%QT_DOCDIR%%/qtcore/images/qpen-dot.png
%%QT_DOCDIR%%/qtcore/images/qpen-flat.png
%%QT_DOCDIR%%/qtcore/images/qpen-miter.png
%%QT_DOCDIR%%/qtcore/images/qpen-roundcap.png
%%QT_DOCDIR%%/qtcore/images/qpen-roundjoin.png
%%QT_DOCDIR%%/qtcore/images/qpen-solid.png
%%QT_DOCDIR%%/qtcore/images/qpen-square.png
%%QT_DOCDIR%%/qtcore/images/qrect-coordinates.png
%%QT_DOCDIR%%/qtcore/images/qrect-diagram-one.png
%%QT_DOCDIR%%/qtcore/images/qrect-diagram-three.png
%%QT_DOCDIR%%/qtcore/images/qrect-diagram-two.png
%%QT_DOCDIR%%/qtcore/images/qrect-diagram-zero.png
%%QT_DOCDIR%%/qtcore/images/qrect-intersect.png
%%QT_DOCDIR%%/qtcore/images/qrect-unite.png
%%QT_DOCDIR%%/qtcore/images/qrectf-coordinates.png
%%QT_DOCDIR%%/qtcore/images/qrectf-diagram-one.png
%%QT_DOCDIR%%/qtcore/images/qrectf-diagram-three.png
%%QT_DOCDIR%%/qtcore/images/qrectf-diagram-two.png
%%QT_DOCDIR%%/qtcore/images/qsortfilterproxymodel-sorting.png
%%QT_DOCDIR%%/qtcore/images/queuedcustomtype-example.png
%%QT_DOCDIR%%/qtcore/images/qurl-authority.png
%%QT_DOCDIR%%/qtcore/images/qurl-authority2.png
%%QT_DOCDIR%%/qtcore/images/qurl-authority3.png
%%QT_DOCDIR%%/qtcore/images/qurl-fragment.png
%%QT_DOCDIR%%/qtcore/images/qurl-ftppath.png
%%QT_DOCDIR%%/qtcore/images/qurl-mailtopath.png
%%QT_DOCDIR%%/qtcore/images/qurl-querystring.png
%%QT_DOCDIR%%/qtcore/images/resources.png
%%QT_DOCDIR%%/qtcore/images/sharedmemory-example_1.png
%%QT_DOCDIR%%/qtcore/images/sharedmemory-example_2.png
%%QT_DOCDIR%%/qtcore/images/statemachine-button-history.png
%%QT_DOCDIR%%/qtcore/images/statemachine-button-nested.png
%%QT_DOCDIR%%/qtcore/images/statemachine-button.png
%%QT_DOCDIR%%/qtcore/images/statemachine-customevents.png
%%QT_DOCDIR%%/qtcore/images/statemachine-customevents2.png
%%QT_DOCDIR%%/qtcore/images/statemachine-finished.png
%%QT_DOCDIR%%/qtcore/images/statemachine-nonparallel.png
%%QT_DOCDIR%%/qtcore/images/statemachine-parallel.png
%%QT_DOCDIR%%/qtcore/images/stliterators1.png
%%QT_DOCDIR%%/qtcore/implicit-sharing.html
%%QT_DOCDIR%%/qtcore/io-functions.html
%%QT_DOCDIR%%/qtcore/io.html
%%QT_DOCDIR%%/qtcore/json.html
%%QT_DOCDIR%%/qtcore/metaobjects.html
%%QT_DOCDIR%%/qtcore/object.html
%%QT_DOCDIR%%/qtcore/objecttrees.html
%%QT_DOCDIR%%/qtcore/plugins.html
%%QT_DOCDIR%%/qtcore/properties.html
%%QT_DOCDIR%%/qtcore/qabstractanimation-members.html
%%QT_DOCDIR%%/qtcore/qabstractanimation.html
%%QT_DOCDIR%%/qtcore/qabstracteventdispatcher-members.html
%%QT_DOCDIR%%/qtcore/qabstracteventdispatcher-obsolete.html
%%QT_DOCDIR%%/qtcore/qabstracteventdispatcher-timerinfo-members.html
%%QT_DOCDIR%%/qtcore/qabstracteventdispatcher-timerinfo.html
%%QT_DOCDIR%%/qtcore/qabstracteventdispatcher.html
%%QT_DOCDIR%%/qtcore/qabstractitemmodel-members.html
%%QT_DOCDIR%%/qtcore/qabstractitemmodel-obsolete.html
%%QT_DOCDIR%%/qtcore/qabstractitemmodel.html
%%QT_DOCDIR%%/qtcore/qabstractlistmodel-members.html
%%QT_DOCDIR%%/qtcore/qabstractlistmodel.html
%%QT_DOCDIR%%/qtcore/qabstractnativeeventfilter-members.html
%%QT_DOCDIR%%/qtcore/qabstractnativeeventfilter.html
%%QT_DOCDIR%%/qtcore/qabstractproxymodel-members.html
%%QT_DOCDIR%%/qtcore/qabstractproxymodel.html
%%QT_DOCDIR%%/qtcore/qabstractstate-members.html
%%QT_DOCDIR%%/qtcore/qabstractstate.html
%%QT_DOCDIR%%/qtcore/qabstracttablemodel-members.html
%%QT_DOCDIR%%/qtcore/qabstracttablemodel.html
%%QT_DOCDIR%%/qtcore/qabstracttransition-members.html
%%QT_DOCDIR%%/qtcore/qabstracttransition.html
%%QT_DOCDIR%%/qtcore/qanimationgroup-members.html
%%QT_DOCDIR%%/qtcore/qanimationgroup.html
%%QT_DOCDIR%%/qtcore/qassociativeiterable-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qassociativeiterable-const-iterator.html
%%QT_DOCDIR%%/qtcore/qassociativeiterable-members.html
%%QT_DOCDIR%%/qtcore/qassociativeiterable.html
%%QT_DOCDIR%%/qtcore/qatomicint-members.html
%%QT_DOCDIR%%/qtcore/qatomicint.html
%%QT_DOCDIR%%/qtcore/qatomicinteger-members.html
%%QT_DOCDIR%%/qtcore/qatomicinteger.html
%%QT_DOCDIR%%/qtcore/qatomicpointer-members.html
%%QT_DOCDIR%%/qtcore/qatomicpointer.html
%%QT_DOCDIR%%/qtcore/qbasictimer-members.html
%%QT_DOCDIR%%/qtcore/qbasictimer.html
%%QT_DOCDIR%%/qtcore/qbitarray-members.html
%%QT_DOCDIR%%/qtcore/qbitarray.html
%%QT_DOCDIR%%/qtcore/qbuffer-members.html
%%QT_DOCDIR%%/qtcore/qbuffer.html
%%QT_DOCDIR%%/qtcore/qbytearray-members.html
%%QT_DOCDIR%%/qtcore/qbytearray-obsolete.html
%%QT_DOCDIR%%/qtcore/qbytearray.html
%%QT_DOCDIR%%/qtcore/qbytearraylist-members.html
%%QT_DOCDIR%%/qtcore/qbytearraylist.html
%%QT_DOCDIR%%/qtcore/qbytearraymatcher-members.html
%%QT_DOCDIR%%/qtcore/qbytearraymatcher.html
%%QT_DOCDIR%%/qtcore/qcache-members.html
%%QT_DOCDIR%%/qtcore/qcache.html
%%QT_DOCDIR%%/qtcore/qchar-members.html
%%QT_DOCDIR%%/qtcore/qchar-obsolete.html
%%QT_DOCDIR%%/qtcore/qchar.html
%%QT_DOCDIR%%/qtcore/qchildevent-members.html
%%QT_DOCDIR%%/qtcore/qchildevent.html
%%QT_DOCDIR%%/qtcore/qcollator-members.html
%%QT_DOCDIR%%/qtcore/qcollator.html
%%QT_DOCDIR%%/qtcore/qcollatorsortkey-members.html
%%QT_DOCDIR%%/qtcore/qcollatorsortkey.html
%%QT_DOCDIR%%/qtcore/qcommandlineoption-members.html
%%QT_DOCDIR%%/qtcore/qcommandlineoption.html
%%QT_DOCDIR%%/qtcore/qcommandlineparser-members.html
%%QT_DOCDIR%%/qtcore/qcommandlineparser.html
%%QT_DOCDIR%%/qtcore/qcontiguouscache-members.html
%%QT_DOCDIR%%/qtcore/qcontiguouscache.html
%%QT_DOCDIR%%/qtcore/qcoreapplication-members.html
%%QT_DOCDIR%%/qtcore/qcoreapplication-obsolete.html
%%QT_DOCDIR%%/qtcore/qcoreapplication.html
%%QT_DOCDIR%%/qtcore/qcryptographichash-members.html
%%QT_DOCDIR%%/qtcore/qcryptographichash.html
%%QT_DOCDIR%%/qtcore/qdatastream-members.html
%%QT_DOCDIR%%/qtcore/qdatastream-obsolete.html
%%QT_DOCDIR%%/qtcore/qdatastream.html
%%QT_DOCDIR%%/qtcore/qdate-members.html
%%QT_DOCDIR%%/qtcore/qdate-obsolete.html
%%QT_DOCDIR%%/qtcore/qdate.html
%%QT_DOCDIR%%/qtcore/qdatetime-members.html
%%QT_DOCDIR%%/qtcore/qdatetime.html
%%QT_DOCDIR%%/qtcore/qdebug-members.html
%%QT_DOCDIR%%/qtcore/qdebug.html
%%QT_DOCDIR%%/qtcore/qdebugstatesaver-members.html
%%QT_DOCDIR%%/qtcore/qdebugstatesaver.html
%%QT_DOCDIR%%/qtcore/qdir-members.html
%%QT_DOCDIR%%/qtcore/qdir-obsolete.html
%%QT_DOCDIR%%/qtcore/qdir.html
%%QT_DOCDIR%%/qtcore/qdiriterator-members.html
%%QT_DOCDIR%%/qtcore/qdiriterator.html
%%QT_DOCDIR%%/qtcore/qdynamicpropertychangeevent-members.html
%%QT_DOCDIR%%/qtcore/qdynamicpropertychangeevent.html
%%QT_DOCDIR%%/qtcore/qeasingcurve-members.html
%%QT_DOCDIR%%/qtcore/qeasingcurve-obsolete.html
%%QT_DOCDIR%%/qtcore/qeasingcurve.html
%%QT_DOCDIR%%/qtcore/qelapsedtimer-members.html
%%QT_DOCDIR%%/qtcore/qelapsedtimer.html
%%QT_DOCDIR%%/qtcore/qenablesharedfromthis-members.html
%%QT_DOCDIR%%/qtcore/qenablesharedfromthis.html
%%QT_DOCDIR%%/qtcore/qevent-members.html
%%QT_DOCDIR%%/qtcore/qevent.html
%%QT_DOCDIR%%/qtcore/qeventloop-members.html
%%QT_DOCDIR%%/qtcore/qeventloop.html
%%QT_DOCDIR%%/qtcore/qeventlooplocker-members.html
%%QT_DOCDIR%%/qtcore/qeventlooplocker.html
%%QT_DOCDIR%%/qtcore/qeventtransition-members.html
%%QT_DOCDIR%%/qtcore/qeventtransition.html
%%QT_DOCDIR%%/qtcore/qexception-members.html
%%QT_DOCDIR%%/qtcore/qexception.html
%%QT_DOCDIR%%/qtcore/qexplicitlyshareddatapointer-members.html
%%QT_DOCDIR%%/qtcore/qexplicitlyshareddatapointer.html
%%QT_DOCDIR%%/qtcore/qfile-members.html
%%QT_DOCDIR%%/qtcore/qfile-obsolete.html
%%QT_DOCDIR%%/qtcore/qfile.html
%%QT_DOCDIR%%/qtcore/qfiledevice-members.html
%%QT_DOCDIR%%/qtcore/qfiledevice.html
%%QT_DOCDIR%%/qtcore/qfileinfo-members.html
%%QT_DOCDIR%%/qtcore/qfileinfo-obsolete.html
%%QT_DOCDIR%%/qtcore/qfileinfo.html
%%QT_DOCDIR%%/qtcore/qfileselector-members.html
%%QT_DOCDIR%%/qtcore/qfileselector.html
%%QT_DOCDIR%%/qtcore/qfilesystemwatcher-members.html
%%QT_DOCDIR%%/qtcore/qfilesystemwatcher.html
%%QT_DOCDIR%%/qtcore/qfinalstate-members.html
%%QT_DOCDIR%%/qtcore/qfinalstate.html
%%QT_DOCDIR%%/qtcore/qflag-members.html
%%QT_DOCDIR%%/qtcore/qflag.html
%%QT_DOCDIR%%/qtcore/qflags-members.html
%%QT_DOCDIR%%/qtcore/qflags.html
%%QT_DOCDIR%%/qtcore/qfuture-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qfuture-const-iterator.html
%%QT_DOCDIR%%/qtcore/qfuture-members.html
%%QT_DOCDIR%%/qtcore/qfuture.html
%%QT_DOCDIR%%/qtcore/qfutureiterator-members.html
%%QT_DOCDIR%%/qtcore/qfutureiterator.html
%%QT_DOCDIR%%/qtcore/qfuturesynchronizer-members.html
%%QT_DOCDIR%%/qtcore/qfuturesynchronizer.html
%%QT_DOCDIR%%/qtcore/qfuturewatcher-members.html
%%QT_DOCDIR%%/qtcore/qfuturewatcher.html
%%QT_DOCDIR%%/qtcore/qgenericargument-members.html
%%QT_DOCDIR%%/qtcore/qgenericargument.html
%%QT_DOCDIR%%/qtcore/qgenericreturnargument-members.html
%%QT_DOCDIR%%/qtcore/qgenericreturnargument.html
%%QT_DOCDIR%%/qtcore/qglobalstatic-members.html
%%QT_DOCDIR%%/qtcore/qglobalstatic-obsolete.html
%%QT_DOCDIR%%/qtcore/qglobalstatic.html
%%QT_DOCDIR%%/qtcore/qhash-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qhash-const-iterator.html
%%QT_DOCDIR%%/qtcore/qhash-iterator-members.html
%%QT_DOCDIR%%/qtcore/qhash-iterator.html
%%QT_DOCDIR%%/qtcore/qhash-key-iterator-members.html
%%QT_DOCDIR%%/qtcore/qhash-key-iterator.html
%%QT_DOCDIR%%/qtcore/qhash-members.html
%%QT_DOCDIR%%/qtcore/qhash.html
%%QT_DOCDIR%%/qtcore/qhashiterator-members.html
%%QT_DOCDIR%%/qtcore/qhashiterator.html
%%QT_DOCDIR%%/qtcore/qhistorystate-members.html
%%QT_DOCDIR%%/qtcore/qhistorystate.html
%%QT_DOCDIR%%/qtcore/qidentityproxymodel-members.html
%%QT_DOCDIR%%/qtcore/qidentityproxymodel.html
%%QT_DOCDIR%%/qtcore/qiodevice-members.html
%%QT_DOCDIR%%/qtcore/qiodevice.html
%%QT_DOCDIR%%/qtcore/qitemselection-members.html
%%QT_DOCDIR%%/qtcore/qitemselection.html
%%QT_DOCDIR%%/qtcore/qitemselectionmodel-members.html
%%QT_DOCDIR%%/qtcore/qitemselectionmodel.html
%%QT_DOCDIR%%/qtcore/qitemselectionrange-members.html
%%QT_DOCDIR%%/qtcore/qitemselectionrange-obsolete.html
%%QT_DOCDIR%%/qtcore/qitemselectionrange.html
%%QT_DOCDIR%%/qtcore/qjsonarray-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qjsonarray-const-iterator.html
%%QT_DOCDIR%%/qtcore/qjsonarray-iterator-members.html
%%QT_DOCDIR%%/qtcore/qjsonarray-iterator.html
%%QT_DOCDIR%%/qtcore/qjsonarray-members.html
%%QT_DOCDIR%%/qtcore/qjsonarray.html
%%QT_DOCDIR%%/qtcore/qjsondocument-members.html
%%QT_DOCDIR%%/qtcore/qjsondocument.html
%%QT_DOCDIR%%/qtcore/qjsonobject-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qjsonobject-const-iterator.html
%%QT_DOCDIR%%/qtcore/qjsonobject-iterator-members.html
%%QT_DOCDIR%%/qtcore/qjsonobject-iterator.html
%%QT_DOCDIR%%/qtcore/qjsonobject-members.html
%%QT_DOCDIR%%/qtcore/qjsonobject.html
%%QT_DOCDIR%%/qtcore/qjsonparseerror-members.html
%%QT_DOCDIR%%/qtcore/qjsonparseerror.html
%%QT_DOCDIR%%/qtcore/qjsonvalue-members.html
%%QT_DOCDIR%%/qtcore/qjsonvalue.html
%%QT_DOCDIR%%/qtcore/qlatin1char-members.html
%%QT_DOCDIR%%/qtcore/qlatin1char.html
%%QT_DOCDIR%%/qtcore/qlatin1string-members.html
%%QT_DOCDIR%%/qtcore/qlatin1string.html
%%QT_DOCDIR%%/qtcore/qlibrary-members.html
%%QT_DOCDIR%%/qtcore/qlibrary.html
%%QT_DOCDIR%%/qtcore/qlibraryinfo-members.html
%%QT_DOCDIR%%/qtcore/qlibraryinfo-obsolete.html
%%QT_DOCDIR%%/qtcore/qlibraryinfo.html
%%QT_DOCDIR%%/qtcore/qline-members.html
%%QT_DOCDIR%%/qtcore/qline.html
%%QT_DOCDIR%%/qtcore/qlinef-members.html
%%QT_DOCDIR%%/qtcore/qlinef-obsolete.html
%%QT_DOCDIR%%/qtcore/qlinef.html
%%QT_DOCDIR%%/qtcore/qlinkedlist-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qlinkedlist-const-iterator.html
%%QT_DOCDIR%%/qtcore/qlinkedlist-iterator-members.html
%%QT_DOCDIR%%/qtcore/qlinkedlist-iterator.html
%%QT_DOCDIR%%/qtcore/qlinkedlist-members.html
%%QT_DOCDIR%%/qtcore/qlinkedlist.html
%%QT_DOCDIR%%/qtcore/qlinkedlistiterator-members.html
%%QT_DOCDIR%%/qtcore/qlinkedlistiterator.html
%%QT_DOCDIR%%/qtcore/qlist-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qlist-const-iterator.html
%%QT_DOCDIR%%/qtcore/qlist-iterator-members.html
%%QT_DOCDIR%%/qtcore/qlist-iterator.html
%%QT_DOCDIR%%/qtcore/qlist-members.html
%%QT_DOCDIR%%/qtcore/qlist-memorylayout.html
%%QT_DOCDIR%%/qtcore/qlist.html
%%QT_DOCDIR%%/qtcore/qlistiterator-members.html
%%QT_DOCDIR%%/qtcore/qlistiterator.html
%%QT_DOCDIR%%/qtcore/qlocale-members.html
%%QT_DOCDIR%%/qtcore/qlocale-obsolete.html
%%QT_DOCDIR%%/qtcore/qlocale.html
%%QT_DOCDIR%%/qtcore/qlockfile-members.html
%%QT_DOCDIR%%/qtcore/qlockfile.html
%%QT_DOCDIR%%/qtcore/qloggingcategory-members.html
%%QT_DOCDIR%%/qtcore/qloggingcategory.html
%%QT_DOCDIR%%/qtcore/qmap-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qmap-const-iterator.html
%%QT_DOCDIR%%/qtcore/qmap-iterator-members.html
%%QT_DOCDIR%%/qtcore/qmap-iterator.html
%%QT_DOCDIR%%/qtcore/qmap-key-iterator-members.html
%%QT_DOCDIR%%/qtcore/qmap-key-iterator.html
%%QT_DOCDIR%%/qtcore/qmap-members.html
%%QT_DOCDIR%%/qtcore/qmap.html
%%QT_DOCDIR%%/qtcore/qmapiterator-members.html
%%QT_DOCDIR%%/qtcore/qmapiterator.html
%%QT_DOCDIR%%/qtcore/qmargins-members.html
%%QT_DOCDIR%%/qtcore/qmargins.html
%%QT_DOCDIR%%/qtcore/qmarginsf-members.html
%%QT_DOCDIR%%/qtcore/qmarginsf.html
%%QT_DOCDIR%%/qtcore/qmessageauthenticationcode-members.html
%%QT_DOCDIR%%/qtcore/qmessageauthenticationcode.html
%%QT_DOCDIR%%/qtcore/qmessagelogcontext-members.html
%%QT_DOCDIR%%/qtcore/qmessagelogcontext.html
%%QT_DOCDIR%%/qtcore/qmessagelogger-members.html
%%QT_DOCDIR%%/qtcore/qmessagelogger.html
%%QT_DOCDIR%%/qtcore/qmetaclassinfo-members.html
%%QT_DOCDIR%%/qtcore/qmetaclassinfo.html
%%QT_DOCDIR%%/qtcore/qmetaenum-members.html
%%QT_DOCDIR%%/qtcore/qmetaenum.html
%%QT_DOCDIR%%/qtcore/qmetamethod-members.html
%%QT_DOCDIR%%/qtcore/qmetamethod.html
%%QT_DOCDIR%%/qtcore/qmetaobject-connection-members.html
%%QT_DOCDIR%%/qtcore/qmetaobject-connection.html
%%QT_DOCDIR%%/qtcore/qmetaobject-members.html
%%QT_DOCDIR%%/qtcore/qmetaobject.html
%%QT_DOCDIR%%/qtcore/qmetaproperty-members.html
%%QT_DOCDIR%%/qtcore/qmetaproperty-obsolete.html
%%QT_DOCDIR%%/qtcore/qmetaproperty.html
%%QT_DOCDIR%%/qtcore/qmetatype-members.html
%%QT_DOCDIR%%/qtcore/qmetatype-obsolete.html
%%QT_DOCDIR%%/qtcore/qmetatype.html
%%QT_DOCDIR%%/qtcore/qmimedata-members.html
%%QT_DOCDIR%%/qtcore/qmimedata.html
%%QT_DOCDIR%%/qtcore/qmimedatabase-members.html
%%QT_DOCDIR%%/qtcore/qmimedatabase.html
%%QT_DOCDIR%%/qtcore/qmimetype-members.html
%%QT_DOCDIR%%/qtcore/qmimetype.html
%%QT_DOCDIR%%/qtcore/qmodelindex-members.html
%%QT_DOCDIR%%/qtcore/qmodelindex.html
%%QT_DOCDIR%%/qtcore/qmultihash-members.html
%%QT_DOCDIR%%/qtcore/qmultihash.html
%%QT_DOCDIR%%/qtcore/qmultimap-members.html
%%QT_DOCDIR%%/qtcore/qmultimap.html
%%QT_DOCDIR%%/qtcore/qmutablehashiterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablehashiterator.html
%%QT_DOCDIR%%/qtcore/qmutablelinkedlistiterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablelinkedlistiterator.html
%%QT_DOCDIR%%/qtcore/qmutablelistiterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablelistiterator.html
%%QT_DOCDIR%%/qtcore/qmutablemapiterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablemapiterator.html
%%QT_DOCDIR%%/qtcore/qmutablesetiterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablesetiterator.html
%%QT_DOCDIR%%/qtcore/qmutablevectoriterator-members.html
%%QT_DOCDIR%%/qtcore/qmutablevectoriterator.html
%%QT_DOCDIR%%/qtcore/qmutex-members.html
%%QT_DOCDIR%%/qtcore/qmutex.html
%%QT_DOCDIR%%/qtcore/qmutexlocker-members.html
%%QT_DOCDIR%%/qtcore/qmutexlocker.html
%%QT_DOCDIR%%/qtcore/qobject-members.html
%%QT_DOCDIR%%/qtcore/qobject-obsolete.html
%%QT_DOCDIR%%/qtcore/qobject.html
%%QT_DOCDIR%%/qtcore/qobjectcleanuphandler-members.html
%%QT_DOCDIR%%/qtcore/qobjectcleanuphandler.html
%%QT_DOCDIR%%/qtcore/qpair-members.html
%%QT_DOCDIR%%/qtcore/qpair.html
%%QT_DOCDIR%%/qtcore/qparallelanimationgroup-members.html
%%QT_DOCDIR%%/qtcore/qparallelanimationgroup.html
%%QT_DOCDIR%%/qtcore/qpauseanimation-members.html
%%QT_DOCDIR%%/qtcore/qpauseanimation.html
%%QT_DOCDIR%%/qtcore/qpersistentmodelindex-members.html
%%QT_DOCDIR%%/qtcore/qpersistentmodelindex.html
%%QT_DOCDIR%%/qtcore/qpluginloader-members.html
%%QT_DOCDIR%%/qtcore/qpluginloader.html
%%QT_DOCDIR%%/qtcore/qpoint-members.html
%%QT_DOCDIR%%/qtcore/qpoint.html
%%QT_DOCDIR%%/qtcore/qpointer-members.html
%%QT_DOCDIR%%/qtcore/qpointer.html
%%QT_DOCDIR%%/qtcore/qpointf-members.html
%%QT_DOCDIR%%/qtcore/qpointf.html
%%QT_DOCDIR%%/qtcore/qprocess-createprocessarguments-members.html
%%QT_DOCDIR%%/qtcore/qprocess-createprocessarguments.html
%%QT_DOCDIR%%/qtcore/qprocess-members.html
%%QT_DOCDIR%%/qtcore/qprocess-obsolete.html
%%QT_DOCDIR%%/qtcore/qprocess.html
%%QT_DOCDIR%%/qtcore/qprocessenvironment-members.html
%%QT_DOCDIR%%/qtcore/qprocessenvironment.html
%%QT_DOCDIR%%/qtcore/qpropertyanimation-members.html
%%QT_DOCDIR%%/qtcore/qpropertyanimation.html
%%QT_DOCDIR%%/qtcore/qqueue-members.html
%%QT_DOCDIR%%/qtcore/qqueue.html
%%QT_DOCDIR%%/qtcore/qreadlocker-members.html
%%QT_DOCDIR%%/qtcore/qreadlocker.html
%%QT_DOCDIR%%/qtcore/qreadwritelock-members.html
%%QT_DOCDIR%%/qtcore/qreadwritelock.html
%%QT_DOCDIR%%/qtcore/qrect-members.html
%%QT_DOCDIR%%/qtcore/qrect-obsolete.html
%%QT_DOCDIR%%/qtcore/qrect.html
%%QT_DOCDIR%%/qtcore/qrectf-members.html
%%QT_DOCDIR%%/qtcore/qrectf-obsolete.html
%%QT_DOCDIR%%/qtcore/qrectf.html
%%QT_DOCDIR%%/qtcore/qregexp-members.html
%%QT_DOCDIR%%/qtcore/qregexp.html
%%QT_DOCDIR%%/qtcore/qregularexpression-members.html
%%QT_DOCDIR%%/qtcore/qregularexpression.html
%%QT_DOCDIR%%/qtcore/qregularexpressionmatch-members.html
%%QT_DOCDIR%%/qtcore/qregularexpressionmatch.html
%%QT_DOCDIR%%/qtcore/qregularexpressionmatchiterator-members.html
%%QT_DOCDIR%%/qtcore/qregularexpressionmatchiterator.html
%%QT_DOCDIR%%/qtcore/qresource-members.html
%%QT_DOCDIR%%/qtcore/qresource-obsolete.html
%%QT_DOCDIR%%/qtcore/qresource.html
%%QT_DOCDIR%%/qtcore/qrunnable-members.html
%%QT_DOCDIR%%/qtcore/qrunnable.html
%%QT_DOCDIR%%/qtcore/qsavefile-members.html
%%QT_DOCDIR%%/qtcore/qsavefile.html
%%QT_DOCDIR%%/qtcore/qscopedarraypointer-members.html
%%QT_DOCDIR%%/qtcore/qscopedarraypointer.html
%%QT_DOCDIR%%/qtcore/qscopedpointer-members.html
%%QT_DOCDIR%%/qtcore/qscopedpointer.html
%%QT_DOCDIR%%/qtcore/qscopedvaluerollback-members.html
%%QT_DOCDIR%%/qtcore/qscopedvaluerollback.html
%%QT_DOCDIR%%/qtcore/qsemaphore-members.html
%%QT_DOCDIR%%/qtcore/qsemaphore.html
%%QT_DOCDIR%%/qtcore/qsequentialanimationgroup-members.html
%%QT_DOCDIR%%/qtcore/qsequentialanimationgroup.html
%%QT_DOCDIR%%/qtcore/qsequentialiterable-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qsequentialiterable-const-iterator.html
%%QT_DOCDIR%%/qtcore/qsequentialiterable-members.html
%%QT_DOCDIR%%/qtcore/qsequentialiterable.html
%%QT_DOCDIR%%/qtcore/qset-const-iterator-members.html
%%QT_DOCDIR%%/qtcore/qset-const-iterator.html
%%QT_DOCDIR%%/qtcore/qset-iterator-members.html
%%QT_DOCDIR%%/qtcore/qset-iterator.html
%%QT_DOCDIR%%/qtcore/qset-members.html
%%QT_DOCDIR%%/qtcore/qset.html
%%QT_DOCDIR%%/qtcore/qsetiterator-members.html
%%QT_DOCDIR%%/qtcore/qsetiterator.html
%%QT_DOCDIR%%/qtcore/qsettings-members.html
%%QT_DOCDIR%%/qtcore/qsettings-obsolete.html
%%QT_DOCDIR%%/qtcore/qsettings.html
%%QT_DOCDIR%%/qtcore/qshareddata-members.html
%%QT_DOCDIR%%/qtcore/qshareddata.html
%%QT_DOCDIR%%/qtcore/qshareddatapointer-members.html
%%QT_DOCDIR%%/qtcore/qshareddatapointer.html
%%QT_DOCDIR%%/qtcore/qsharedmemory-members.html
%%QT_DOCDIR%%/qtcore/qsharedmemory.html
%%QT_DOCDIR%%/qtcore/qsharedpointer-members.html
%%QT_DOCDIR%%/qtcore/qsharedpointer.html
%%QT_DOCDIR%%/qtcore/qsignalblocker-members.html
%%QT_DOCDIR%%/qtcore/qsignalblocker.html
%%QT_DOCDIR%%/qtcore/qsignalmapper-members.html
%%QT_DOCDIR%%/qtcore/qsignalmapper.html
%%QT_DOCDIR%%/qtcore/qsignaltransition-members.html
%%QT_DOCDIR%%/qtcore/qsignaltransition.html
%%QT_DOCDIR%%/qtcore/qsize-members.html
%%QT_DOCDIR%%/qtcore/qsize.html
%%QT_DOCDIR%%/qtcore/qsizef-members.html
%%QT_DOCDIR%%/qtcore/qsizef.html
%%QT_DOCDIR%%/qtcore/qsocketnotifier-members.html
%%QT_DOCDIR%%/qtcore/qsocketnotifier.html
%%QT_DOCDIR%%/qtcore/qsortfilterproxymodel-members.html
%%QT_DOCDIR%%/qtcore/qsortfilterproxymodel-obsolete.html
%%QT_DOCDIR%%/qtcore/qsortfilterproxymodel.html
%%QT_DOCDIR%%/qtcore/qstack-members.html
%%QT_DOCDIR%%/qtcore/qstack.html
%%QT_DOCDIR%%/qtcore/qstandardpaths-members.html
%%QT_DOCDIR%%/qtcore/qstandardpaths-obsolete.html
%%QT_DOCDIR%%/qtcore/qstandardpaths.html
%%QT_DOCDIR%%/qtcore/qstate-members.html
%%QT_DOCDIR%%/qtcore/qstate.html
%%QT_DOCDIR%%/qtcore/qstatemachine-members.html
%%QT_DOCDIR%%/qtcore/qstatemachine-signalevent-members.html
%%QT_DOCDIR%%/qtcore/qstatemachine-signalevent.html
%%QT_DOCDIR%%/qtcore/qstatemachine-wrappedevent-members.html
%%QT_DOCDIR%%/qtcore/qstatemachine-wrappedevent.html
%%QT_DOCDIR%%/qtcore/qstatemachine.html
%%QT_DOCDIR%%/qtcore/qstaticplugin-members.html
%%QT_DOCDIR%%/qtcore/qstaticplugin.html
%%QT_DOCDIR%%/qtcore/qstorageinfo-members.html
%%QT_DOCDIR%%/qtcore/qstorageinfo.html
%%QT_DOCDIR%%/qtcore/qstring-members.html
%%QT_DOCDIR%%/qtcore/qstring-null.html
%%QT_DOCDIR%%/qtcore/qstring-obsolete.html
%%QT_DOCDIR%%/qtcore/qstring.html
%%QT_DOCDIR%%/qtcore/qstringlist-members.html
%%QT_DOCDIR%%/qtcore/qstringlist.html
%%QT_DOCDIR%%/qtcore/qstringlistmodel-members.html
%%QT_DOCDIR%%/qtcore/qstringlistmodel.html
%%QT_DOCDIR%%/qtcore/qstringmatcher-members.html
%%QT_DOCDIR%%/qtcore/qstringmatcher.html
%%QT_DOCDIR%%/qtcore/qstringref-members.html
%%QT_DOCDIR%%/qtcore/qstringref-obsolete.html
%%QT_DOCDIR%%/qtcore/qstringref.html
%%QT_DOCDIR%%/qtcore/qsysinfo-members.html
%%QT_DOCDIR%%/qtcore/qsysinfo.html
%%QT_DOCDIR%%/qtcore/qsystemsemaphore-members.html
%%QT_DOCDIR%%/qtcore/qsystemsemaphore.html
%%QT_DOCDIR%%/qtcore/qt-obsolete.html
%%QT_DOCDIR%%/qtcore/qt.html
%%QT_DOCDIR%%/qtcore/qtalgorithms-obsolete.html
%%QT_DOCDIR%%/qtcore/qtalgorithms.html
%%QT_DOCDIR%%/qtcore/qtcore-index.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneclient-client-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneclient-client-h.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneclient-example.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneclient-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneserver-example.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneserver-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneserver-server-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-localfortuneserver-server-h.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-dialog-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-dialog-h.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-dialog-ui.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-example.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-ipc-sharedmemory-sharedmemory-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-character-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-character-h.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-example.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-game-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-game-h.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-level-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-level-h.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-json-savegame-savegame-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
%%QT_DOCDIR%%/qtcore/qtcore-module.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-example.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-mandelbrot-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-h.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-renderthread-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-mandelbrot-renderthread-h.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-block-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-block-h.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-example.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-renderthread-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-renderthread-h.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-window-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-queuedcustomtype-window-h.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-semaphores-example.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-semaphores-semaphores-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-semaphores-semaphores-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-waitconditions-example.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-waitconditions-waitconditions-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-threads-waitconditions-waitconditions-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-contiguouscache-contiguouscache-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-contiguouscache-example.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-contiguouscache-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-contiguouscache-randomlistmodel-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-contiguouscache-randomlistmodel-h.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-customtype-customtype-pro.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-customtype-example.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-customtype-main-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-customtype-message-cpp.html
%%QT_DOCDIR%%/qtcore/qtcore-tools-customtype-message-h.html
%%QT_DOCDIR%%/qtcore/qtcore.index
%%QT_DOCDIR%%/qtcore/qtcore.qhp
%%QT_DOCDIR%%/qtcore/qtcore.qhp.sha1
%%QT_DOCDIR%%/qtcore/qtcore.tags
%%QT_DOCDIR%%/qtcore/qtemporarydir-members.html
%%QT_DOCDIR%%/qtcore/qtemporarydir.html
%%QT_DOCDIR%%/qtcore/qtemporaryfile-members.html
%%QT_DOCDIR%%/qtcore/qtemporaryfile-obsolete.html
%%QT_DOCDIR%%/qtcore/qtemporaryfile.html
%%QT_DOCDIR%%/qtcore/qtendian.html
%%QT_DOCDIR%%/qtcore/qtextboundaryfinder-members.html
%%QT_DOCDIR%%/qtcore/qtextboundaryfinder.html
%%QT_DOCDIR%%/qtcore/qtextcodec-converterstate-members.html
%%QT_DOCDIR%%/qtcore/qtextcodec-converterstate.html
%%QT_DOCDIR%%/qtcore/qtextcodec-members.html
%%QT_DOCDIR%%/qtcore/qtextcodec-obsolete.html
%%QT_DOCDIR%%/qtcore/qtextcodec.html
%%QT_DOCDIR%%/qtcore/qtextdecoder-members.html
%%QT_DOCDIR%%/qtcore/qtextdecoder.html
%%QT_DOCDIR%%/qtcore/qtextencoder-members.html
%%QT_DOCDIR%%/qtcore/qtextencoder.html
%%QT_DOCDIR%%/qtcore/qtextstream-members.html
%%QT_DOCDIR%%/qtcore/qtextstream.html
%%QT_DOCDIR%%/qtcore/qtglobal-obsolete.html
%%QT_DOCDIR%%/qtcore/qtglobal.html
%%QT_DOCDIR%%/qtcore/qthread-members.html
%%QT_DOCDIR%%/qtcore/qthread.html
%%QT_DOCDIR%%/qtcore/qthreadpool-members.html
%%QT_DOCDIR%%/qtcore/qthreadpool.html
%%QT_DOCDIR%%/qtcore/qthreadstorage-members.html
%%QT_DOCDIR%%/qtcore/qthreadstorage.html
%%QT_DOCDIR%%/qtcore/qtime-members.html
%%QT_DOCDIR%%/qtcore/qtime.html
%%QT_DOCDIR%%/qtcore/qtimeline-members.html
%%QT_DOCDIR%%/qtcore/qtimeline.html
%%QT_DOCDIR%%/qtcore/qtimer-members.html
%%QT_DOCDIR%%/qtcore/qtimer.html
%%QT_DOCDIR%%/qtcore/qtimerevent-members.html
%%QT_DOCDIR%%/qtcore/qtimerevent.html
%%QT_DOCDIR%%/qtcore/qtimezone-members.html
%%QT_DOCDIR%%/qtcore/qtimezone-offsetdata-members.html
%%QT_DOCDIR%%/qtcore/qtimezone-offsetdata.html
%%QT_DOCDIR%%/qtcore/qtimezone.html
%%QT_DOCDIR%%/qtcore/qtmath.html
%%QT_DOCDIR%%/qtcore/qtplugin.html
%%QT_DOCDIR%%/qtcore/qtranslator-members.html
%%QT_DOCDIR%%/qtcore/qtranslator.html
%%QT_DOCDIR%%/qtcore/qunhandledexception-members.html
%%QT_DOCDIR%%/qtcore/qunhandledexception.html
%%QT_DOCDIR%%/qtcore/qurl-members.html
%%QT_DOCDIR%%/qtcore/qurl-obsolete.html
%%QT_DOCDIR%%/qtcore/qurl.html
%%QT_DOCDIR%%/qtcore/qurlquery-members.html
%%QT_DOCDIR%%/qtcore/qurlquery.html
%%QT_DOCDIR%%/qtcore/quuid-members.html
%%QT_DOCDIR%%/qtcore/quuid.html
%%QT_DOCDIR%%/qtcore/qvariant-members.html
%%QT_DOCDIR%%/qtcore/qvariant-obsolete.html
%%QT_DOCDIR%%/qtcore/qvariant.html
%%QT_DOCDIR%%/qtcore/qvariantanimation-members.html
%%QT_DOCDIR%%/qtcore/qvariantanimation.html
%%QT_DOCDIR%%/qtcore/qvarlengtharray-members.html
%%QT_DOCDIR%%/qtcore/qvarlengtharray.html
%%QT_DOCDIR%%/qtcore/qvector-members.html
%%QT_DOCDIR%%/qtcore/qvector.html
%%QT_DOCDIR%%/qtcore/qvectoriterator-members.html
%%QT_DOCDIR%%/qtcore/qvectoriterator.html
%%QT_DOCDIR%%/qtcore/qversionnumber-members.html
%%QT_DOCDIR%%/qtcore/qversionnumber.html
%%QT_DOCDIR%%/qtcore/qwaitcondition-members.html
%%QT_DOCDIR%%/qtcore/qwaitcondition.html
%%QT_DOCDIR%%/qtcore/qweakpointer-members.html
%%QT_DOCDIR%%/qtcore/qweakpointer-obsolete.html
%%QT_DOCDIR%%/qtcore/qweakpointer.html
%%QT_DOCDIR%%/qtcore/qwineventnotifier-members.html
%%QT_DOCDIR%%/qtcore/qwineventnotifier.html
%%QT_DOCDIR%%/qtcore/qwritelocker-members.html
%%QT_DOCDIR%%/qtcore/qwritelocker.html
%%QT_DOCDIR%%/qtcore/qxmlstreamattribute-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamattribute.html
%%QT_DOCDIR%%/qtcore/qxmlstreamattributes-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamattributes.html
%%QT_DOCDIR%%/qtcore/qxmlstreamentitydeclaration-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamentitydeclaration.html
%%QT_DOCDIR%%/qtcore/qxmlstreamentityresolver-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamentityresolver.html
%%QT_DOCDIR%%/qtcore/qxmlstreamnamespacedeclaration-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamnamespacedeclaration.html
%%QT_DOCDIR%%/qtcore/qxmlstreamnotationdeclaration-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamnotationdeclaration.html
%%QT_DOCDIR%%/qtcore/qxmlstreamreader-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamreader.html
%%QT_DOCDIR%%/qtcore/qxmlstreamwriter-members.html
%%QT_DOCDIR%%/qtcore/qxmlstreamwriter.html
%%QT_DOCDIR%%/qtcore/resources.html
%%QT_DOCDIR%%/qtcore/shared.html
%%QT_DOCDIR%%/qtcore/signalsandslots.html
%%QT_DOCDIR%%/qtcore/statemachine-api.html
%%QT_DOCDIR%%/qtcore/statemachine.html
%%QT_DOCDIR%%/qtcore/style/offline-simple.css
%%QT_DOCDIR%%/qtcore/style/offline.css
%%QT_DOCDIR%%/qtcore/timers.html
%%QT_DOCDIR%%/qtdatavis3d.qch
%%QT_DOCDIR%%/qtdatavisualization/datavisualization-examples.html
%%QT_DOCDIR%%/qtdatavisualization/examples-manifest.xml
%%QT_DOCDIR%%/qtdatavisualization/images/arrow_bc.png
%%QT_DOCDIR%%/qtdatavisualization/images/audiolevels-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/bars-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/bgrContent.png
%%QT_DOCDIR%%/qtdatavisualization/images/btn_next.png
%%QT_DOCDIR%%/qtdatavisualization/images/btn_prev.png
%%QT_DOCDIR%%/qtdatavisualization/images/bullet_dn.png
%%QT_DOCDIR%%/qtdatavisualization/images/bullet_sq.png
%%QT_DOCDIR%%/qtdatavisualization/images/custominput-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/customitems-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/customproxy-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/draggableaxes-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/home.png
%%QT_DOCDIR%%/qtdatavisualization/images/ico_note.png
%%QT_DOCDIR%%/qtdatavisualization/images/ico_note_attention.png
%%QT_DOCDIR%%/qtdatavisualization/images/ico_out.png
%%QT_DOCDIR%%/qtdatavisualization/images/itemmodel-example-2.png
%%QT_DOCDIR%%/qtdatavisualization/images/itemmodel-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/logo.png
%%QT_DOCDIR%%/qtdatavisualization/images/q3dbars-minimal.png
%%QT_DOCDIR%%/qtdatavisualization/images/q3dscatter-minimal.png
%%QT_DOCDIR%%/qtdatavisualization/images/q3dsurface-minimal.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlaxisdrag-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlaxisformatter-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlbars-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlcustominput-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmllegend-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlmultigraph-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmloscilloscope-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlscatter-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlspectrogram-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlsurface-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/qmlsurfacelayers-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/rotations-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/scatter-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/surface-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/texturesurface-example.png
%%QT_DOCDIR%%/qtdatavisualization/images/volumetric-example.png
%%QT_DOCDIR%%/qtdatavisualization/q3dbars-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dbars.html
%%QT_DOCDIR%%/qtdatavisualization/q3dcamera-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dcamera.html
%%QT_DOCDIR%%/qtdatavisualization/q3dinputhandler-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dinputhandler.html
%%QT_DOCDIR%%/qtdatavisualization/q3dlight-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dlight.html
%%QT_DOCDIR%%/qtdatavisualization/q3dobject-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dobject.html
%%QT_DOCDIR%%/qtdatavisualization/q3dscatter-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dscatter.html
%%QT_DOCDIR%%/qtdatavisualization/q3dscene-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dscene.html
%%QT_DOCDIR%%/qtdatavisualization/q3dsurface-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dsurface.html
%%QT_DOCDIR%%/qtdatavisualization/q3dtheme-members.html
%%QT_DOCDIR%%/qtdatavisualization/q3dtheme.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3daxis-members.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3daxis.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dgraph-members.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dgraph.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dinputhandler-members.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dinputhandler.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qabstract3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qabstractdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qabstractdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qbar3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qbar3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qbardataitem-members.html
%%QT_DOCDIR%%/qtdatavisualization/qbardataitem.html
%%QT_DOCDIR%%/qtdatavisualization/qbardataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qbardataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qcategory3daxis-members.html
%%QT_DOCDIR%%/qtdatavisualization/qcategory3daxis.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3ditem-members.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3ditem.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3dlabel-members.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3dlabel.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3dvolume-members.html
%%QT_DOCDIR%%/qtdatavisualization/qcustom3dvolume.html
%%QT_DOCDIR%%/qtdatavisualization/qheightmapsurfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qheightmapsurfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelbardataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelbardataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelscatterdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelscatterdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelsurfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qitemmodelsurfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qlogvalue3daxisformatter-members.html
%%QT_DOCDIR%%/qtdatavisualization/qlogvalue3daxisformatter.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstract3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstract3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bar3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bar3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bardataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bardataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bars3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-bars3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-camera3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-camera3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-colorgradient-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-colorgradient.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-colorgradientstop-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-colorgradientstop.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3ditem-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3ditem.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3dlabel-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3dlabel.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3dvolume-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-custom3dvolume.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-inputhandler3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-inputhandler3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-light3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-light3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatter3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatter3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatter3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatter3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scene3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-scene3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surface3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surface3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surface3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surface3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-theme3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-theme3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-themecolor-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-themecolor.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-valueaxis3d-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-valueaxis3d.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter-members.html
%%QT_DOCDIR%%/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter.html
%%QT_DOCDIR%%/qtdatavisualization/qscatter3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qscatter3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qscatterdataitem-members.html
%%QT_DOCDIR%%/qtdatavisualization/qscatterdataitem.html
%%QT_DOCDIR%%/qtdatavisualization/qscatterdataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qscatterdataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qsurface3dseries-members.html
%%QT_DOCDIR%%/qtdatavisualization/qsurface3dseries.html
%%QT_DOCDIR%%/qtdatavisualization/qsurfacedataitem-members.html
%%QT_DOCDIR%%/qtdatavisualization/qsurfacedataitem.html
%%QT_DOCDIR%%/qtdatavisualization/qsurfacedataproxy-members.html
%%QT_DOCDIR%%/qtdatavisualization/qsurfacedataproxy.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavis3d.qhp
%%QT_DOCDIR%%/qtdatavisualization/qtdatavis3d.qhp.sha1
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-audiolevels-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-audiolevelsiodevice-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-audiolevelsiodevice-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-audiolevels-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-bars-bars-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-bars-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-bars-graphmodifier-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-bars-graphmodifier-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-bars-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-custominput-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-custominput-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-custominputhandler-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-custominputhandler-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-scatterdatamodifier-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-custominput-scatterdatamodifier-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-customitemgraph-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-customitemgraph-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-customitems-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-customitems-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customitems-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-customproxy-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-customproxy-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-rainfallgraph-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-rainfallgraph-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantbardatamapping-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantbardatamapping-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantbardataproxy-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantbardataproxy-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantdataset-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-customproxy-variantdataset-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-data-handling.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-axesinputhandler-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-axesinputhandler-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-data-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-data-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-draggableaxes-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-draggableaxes-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-getting-started.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-index.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-interacting-with-data.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-itemmodel-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-itemmodel-itemmodel-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-itemmodel-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-known-issues.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-module.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qmlaxisdrag-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisdrag-qmlaxisdrag-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-customformatter-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-customformatter-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qmlaxisformatter-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlaxisformatter-qmlaxisformatter-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-axes-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-qml-qmlbars-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-qmlbars-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlbars-qmlbars-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-qml-qmlcustominput-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-qmlcustominput-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlcustominput-qmlcustominput-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-legenditem-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qml-qmllegend-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qmllegend-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmllegend-qmllegend-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmodule.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-qmlmultigraph-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlmultigraph-qmlmultigraph-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-datasource-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-datasource-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-qmloscilloscope-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmloscilloscope-qmloscilloscope-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-qml-qmlscatter-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-qmlscatter-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlscatter-qmlscatter-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-qmlspectrogram-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlspectrogram-qmlspectrogram-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-data-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-qml-qmlsurface-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-qmlsurface-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurface-qmlsurface-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-main-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-newbutton-qml.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-rotations-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-rotations-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-scatterdatamodifier-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-rotations-scatterdatamodifier-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-scatter-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-scatter-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-scatter-scatter-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-scatter-scatterdatamodifier-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-scatter-scatterdatamodifier-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-surface-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-surface-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-surfacegraph-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-surface-surfacegraph-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-custominputhandler-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-custominputhandler-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-highlightseries-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-highlightseries-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-surfacegraph-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-surfacegraph-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-texturedsurface-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-texturesurface-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-topographicseries-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-texturesurface-topographicseries-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-example.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-main-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-volumetric-cpp.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-volumetric-h.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-volumetric-pro.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization-volumetric-volumetric-qrc.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization.html
%%QT_DOCDIR%%/qtdatavisualization/qtdatavisualization.index
%%QT_DOCDIR%%/qtdatavisualization/qtouch3dinputhandler-members.html
%%QT_DOCDIR%%/qtdatavisualization/qtouch3dinputhandler.html
%%QT_DOCDIR%%/qtdatavisualization/qvalue3daxis-members.html
%%QT_DOCDIR%%/qtdatavisualization/qvalue3daxis.html
%%QT_DOCDIR%%/qtdatavisualization/qvalue3daxisformatter-members.html
%%QT_DOCDIR%%/qtdatavisualization/qvalue3daxisformatter.html
%%QT_DOCDIR%%/qtdatavisualization/style/offline-simple.css
%%QT_DOCDIR%%/qtdatavisualization/style/offline.css
%%QT_DOCDIR%%/qtdbus.qch
%%QT_DOCDIR%%/qtdbus/examples-dbus.html
%%QT_DOCDIR%%/qtdbus/examples-manifest.xml
%%QT_DOCDIR%%/qtdbus/images/arrow_bc.png
%%QT_DOCDIR%%/qtdbus/images/bgrContent.png
%%QT_DOCDIR%%/qtdbus/images/btn_next.png
%%QT_DOCDIR%%/qtdbus/images/btn_prev.png
%%QT_DOCDIR%%/qtdbus/images/bullet_dn.png
%%QT_DOCDIR%%/qtdbus/images/bullet_sq.png
%%QT_DOCDIR%%/qtdbus/images/dbus-chat-example.png
%%QT_DOCDIR%%/qtdbus/images/home.png
%%QT_DOCDIR%%/qtdbus/images/ico_note.png
%%QT_DOCDIR%%/qtdbus/images/ico_note_attention.png
%%QT_DOCDIR%%/qtdbus/images/ico_out.png
%%QT_DOCDIR%%/qtdbus/images/logo.png
%%QT_DOCDIR%%/qtdbus/images/qurl-ftppath.png
%%QT_DOCDIR%%/qtdbus/images/remotecontrolledcar-car-example.png
%%QT_DOCDIR%%/qtdbus/qdbus.html
%%QT_DOCDIR%%/qtdbus/qdbusabstractadaptor-members.html
%%QT_DOCDIR%%/qtdbus/qdbusabstractadaptor.html
%%QT_DOCDIR%%/qtdbus/qdbusabstractinterface-members.html
%%QT_DOCDIR%%/qtdbus/qdbusabstractinterface.html
%%QT_DOCDIR%%/qtdbus/qdbusadaptorexample.html
%%QT_DOCDIR%%/qtdbus/qdbusargument-members.html
%%QT_DOCDIR%%/qtdbus/qdbusargument.html
%%QT_DOCDIR%%/qtdbus/qdbusconnection-members.html
%%QT_DOCDIR%%/qtdbus/qdbusconnection-obsolete.html
%%QT_DOCDIR%%/qtdbus/qdbusconnection.html
%%QT_DOCDIR%%/qtdbus/qdbusconnectioninterface-members.html
%%QT_DOCDIR%%/qtdbus/qdbusconnectioninterface-obsolete.html
%%QT_DOCDIR%%/qtdbus/qdbusconnectioninterface.html
%%QT_DOCDIR%%/qtdbus/qdbuscontext-members.html
%%QT_DOCDIR%%/qtdbus/qdbuscontext.html
%%QT_DOCDIR%%/qtdbus/qdbusdeclaringsignals.html
%%QT_DOCDIR%%/qtdbus/qdbusdeclaringslots.html
%%QT_DOCDIR%%/qtdbus/qdbuserror-members.html
%%QT_DOCDIR%%/qtdbus/qdbuserror.html
%%QT_DOCDIR%%/qtdbus/qdbusinterface-members.html
%%QT_DOCDIR%%/qtdbus/qdbusinterface.html
%%QT_DOCDIR%%/qtdbus/qdbusmessage-members.html
%%QT_DOCDIR%%/qtdbus/qdbusmessage.html
%%QT_DOCDIR%%/qtdbus/qdbusobjectpath-members.html
%%QT_DOCDIR%%/qtdbus/qdbusobjectpath.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingcall-members.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingcall.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingcallwatcher-members.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingcallwatcher.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingreply-members.html
%%QT_DOCDIR%%/qtdbus/qdbuspendingreply.html
%%QT_DOCDIR%%/qtdbus/qdbusreply-members.html
%%QT_DOCDIR%%/qtdbus/qdbusreply.html
%%QT_DOCDIR%%/qtdbus/qdbusserver-members.html
%%QT_DOCDIR%%/qtdbus/qdbusserver.html
%%QT_DOCDIR%%/qtdbus/qdbusservicewatcher-members.html
%%QT_DOCDIR%%/qtdbus/qdbusservicewatcher.html
%%QT_DOCDIR%%/qtdbus/qdbussignature-members.html
%%QT_DOCDIR%%/qtdbus/qdbussignature.html
%%QT_DOCDIR%%/qtdbus/qdbustypesystem.html
%%QT_DOCDIR%%/qtdbus/qdbusunixfiledescriptor-members.html
%%QT_DOCDIR%%/qtdbus/qdbusunixfiledescriptor.html
%%QT_DOCDIR%%/qtdbus/qdbusvariant-members.html
%%QT_DOCDIR%%/qtdbus/qdbusvariant.html
%%QT_DOCDIR%%/qtdbus/qdbusviewer.html
%%QT_DOCDIR%%/qtdbus/qdbusvirtualobject-members.html
%%QT_DOCDIR%%/qtdbus/qdbusvirtualobject.html
%%QT_DOCDIR%%/qtdbus/qdbusxml2cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-chat-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-chat-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-chat-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-chatmainwindow-ui.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-chatsetnickname-ui.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-example.html
%%QT_DOCDIR%%/qtdbus/qtdbus-chat-org-example-chat-xml.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexping-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexping-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexping-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexpingpong-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexpong-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexpong-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-complexpong-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-example.html
%%QT_DOCDIR%%/qtdbus/qtdbus-complexpingpong-ping-common-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-index.html
%%QT_DOCDIR%%/qtdbus/qtdbus-listnames-example.html
%%QT_DOCDIR%%/qtdbus/qtdbus-listnames-listnames-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-listnames-listnames-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-module.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-example.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-ping-common-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-ping-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-ping-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-pingpong-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-pong-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-pong-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-pingpong-pong-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-car-car-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-car-car-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-car-car-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-car-car-xml.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-car-main-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-controller-car-xml.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-controller-controller-cpp.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-controller-controller-h.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-controller-controller-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-controller-controller-ui.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-example.html
%%QT_DOCDIR%%/qtdbus/qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
%%QT_DOCDIR%%/qtdbus/qtdbus.index
%%QT_DOCDIR%%/qtdbus/qtdbus.qhp
%%QT_DOCDIR%%/qtdbus/qtdbus.qhp.sha1
%%QT_DOCDIR%%/qtdbus/style/offline-simple.css
%%QT_DOCDIR%%/qtdbus/style/offline.css
%%QT_DOCDIR%%/qtdbus/usingadaptors.html
%%QT_DOCDIR%%/qtdesigner.qch
%%QT_DOCDIR%%/qtdesigner/designer-buddy-mode.html
%%QT_DOCDIR%%/qtdesigner/designer-connection-mode.html
%%QT_DOCDIR%%/qtdesigner/designer-creating-custom-widgets-extensions.html
%%QT_DOCDIR%%/qtdesigner/designer-creating-custom-widgets.html
%%QT_DOCDIR%%/qtdesigner/designer-creating-mainwindows.html
%%QT_DOCDIR%%/qtdesigner/designer-customizing-forms.html
%%QT_DOCDIR%%/qtdesigner/designer-editing-mode.html
%%QT_DOCDIR%%/qtdesigner/designer-layouts.html
%%QT_DOCDIR%%/qtdesigner/designer-license-information.html
%%QT_DOCDIR%%/qtdesigner/designer-preview.html
%%QT_DOCDIR%%/qtdesigner/designer-quick-start.html
%%QT_DOCDIR%%/qtdesigner/designer-resources.html
%%QT_DOCDIR%%/qtdesigner/designer-stylesheet.html
%%QT_DOCDIR%%/qtdesigner/designer-tab-order.html
%%QT_DOCDIR%%/qtdesigner/designer-to-know.html
%%QT_DOCDIR%%/qtdesigner/designer-ui-file-format.html
%%QT_DOCDIR%%/qtdesigner/designer-using-a-ui-file.html
%%QT_DOCDIR%%/qtdesigner/designer-using-containers.html
%%QT_DOCDIR%%/qtdesigner/designer-using-custom-widgets.html
%%QT_DOCDIR%%/qtdesigner/designer-widget-mode.html
%%QT_DOCDIR%%/qtdesigner/examples-designer.html
%%QT_DOCDIR%%/qtdesigner/examples-manifest.xml
%%QT_DOCDIR%%/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
%%QT_DOCDIR%%/qtdesigner/images/arrow_bc.png
%%QT_DOCDIR%%/qtdesigner/images/bgrContent.png
%%QT_DOCDIR%%/qtdesigner/images/btn_next.png
%%QT_DOCDIR%%/qtdesigner/images/btn_prev.png
%%QT_DOCDIR%%/qtdesigner/images/bullet_dn.png
%%QT_DOCDIR%%/qtdesigner/images/bullet_sq.png
%%QT_DOCDIR%%/qtdesigner/images/calculatorbuilder-example.png
%%QT_DOCDIR%%/qtdesigner/images/calculatorform-example.png
%%QT_DOCDIR%%/qtdesigner/images/containerextension-example.png
%%QT_DOCDIR%%/qtdesigner/images/customwidgetplugin-example.png
%%QT_DOCDIR%%/qtdesigner/images/designer-action-editor.png
%%QT_DOCDIR%%/qtdesigner/images/designer-add-files-button.png
%%QT_DOCDIR%%/qtdesigner/images/designer-add-resource-entry-button.png
%%QT_DOCDIR%%/qtdesigner/images/designer-adding-dockwidget.png
%%QT_DOCDIR%%/qtdesigner/images/designer-adding-menu-action.png
%%QT_DOCDIR%%/qtdesigner/images/designer-adding-toolbar-action.png
%%QT_DOCDIR%%/qtdesigner/images/designer-buddy-making.png
%%QT_DOCDIR%%/qtdesigner/images/designer-buddy-mode.png
%%QT_DOCDIR%%/qtdesigner/images/designer-buddy-tool.png
%%QT_DOCDIR%%/qtdesigner/images/designer-choosing-form.png
%%QT_DOCDIR%%/qtdesigner/images/designer-code-viewer.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-dialog.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-editing.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-editor.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-highlight.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-making.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-mode.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-to-form.png
%%QT_DOCDIR%%/qtdesigner/images/designer-connection-tool.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-dockwidget.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-frame.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-groupbox.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-stackedwidget.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-tabwidget.png
%%QT_DOCDIR%%/qtdesigner/images/designer-containers-toolbox.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu-entry1.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu-entry2.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu-entry3.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu-entry4.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu1.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu2.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu3.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-menu4.png
%%QT_DOCDIR%%/qtdesigner/images/designer-creating-toolbar.png
%%QT_DOCDIR%%/qtdesigner/images/designer-dialog-preview.png
%%QT_DOCDIR%%/qtdesigner/images/designer-dragging-onto-form.png
%%QT_DOCDIR%%/qtdesigner/images/designer-edit-resource.png
%%QT_DOCDIR%%/qtdesigner/images/designer-edit-resources-button.png
%%QT_DOCDIR%%/qtdesigner/images/designer-editing-mode.png
%%QT_DOCDIR%%/qtdesigner/images/designer-english-dialog.png
%%QT_DOCDIR%%/qtdesigner/images/designer-file-menu.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-layout-cleanlooks.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-layout-macintosh.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-layout-windowsXP.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-layout.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-layoutfunction.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-settings.png
%%QT_DOCDIR%%/qtdesigner/images/designer-form-viewcode.png
%%QT_DOCDIR%%/qtdesigner/images/designer-french-dialog.png
%%QT_DOCDIR%%/qtdesigner/images/designer-layout-inserting.png
%%QT_DOCDIR%%/qtdesigner/images/designer-main-window.png
%%QT_DOCDIR%%/qtdesigner/images/designer-manual-containerextension.png
%%QT_DOCDIR%%/qtdesigner/images/designer-manual-membersheetextension.png
%%QT_DOCDIR%%/qtdesigner/images/designer-manual-propertysheetextension.png
%%QT_DOCDIR%%/qtdesigner/images/designer-manual-taskmenuextension.png
%%QT_DOCDIR%%/qtdesigner/images/designer-multiple-screenshot.png
%%QT_DOCDIR%%/qtdesigner/images/designer-object-inspector.png
%%QT_DOCDIR%%/qtdesigner/images/designer-preview-deviceskin-selection.png
%%QT_DOCDIR%%/qtdesigner/images/designer-preview-style-selection.png
%%QT_DOCDIR%%/qtdesigner/images/designer-preview-style.png
%%QT_DOCDIR%%/qtdesigner/images/designer-preview-stylesheet.png
%%QT_DOCDIR%%/qtdesigner/images/designer-promoting-widgets.png
%%QT_DOCDIR%%/qtdesigner/images/designer-property-editor-add-dynamic.png
%%QT_DOCDIR%%/qtdesigner/images/designer-property-editor-configure.png
%%QT_DOCDIR%%/qtdesigner/images/designer-property-editor-remove-dynamic.png
%%QT_DOCDIR%%/qtdesigner/images/designer-property-editor-toolbar.png
%%QT_DOCDIR%%/qtdesigner/images/designer-property-editor.png
%%QT_DOCDIR%%/qtdesigner/images/designer-reload-resources-button.png
%%QT_DOCDIR%%/qtdesigner/images/designer-remove-resource-entry-button.png
%%QT_DOCDIR%%/qtdesigner/images/designer-removing-toolbar-action.png
%%QT_DOCDIR%%/qtdesigner/images/designer-resource-browser.png
%%QT_DOCDIR%%/qtdesigner/images/designer-resource-selector.png
%%QT_DOCDIR%%/qtdesigner/images/designer-resources-editing.png
%%QT_DOCDIR%%/qtdesigner/images/designer-resources-using.png
%%QT_DOCDIR%%/qtdesigner/images/designer-screenshot.png
%%QT_DOCDIR%%/qtdesigner/images/designer-selecting-widget.png
%%QT_DOCDIR%%/qtdesigner/images/designer-set-layout.png
%%QT_DOCDIR%%/qtdesigner/images/designer-set-layout2.png
%%QT_DOCDIR%%/qtdesigner/images/designer-splitter-layout.png
%%QT_DOCDIR%%/qtdesigner/images/designer-stylesheet-options.png
%%QT_DOCDIR%%/qtdesigner/images/designer-stylesheet-usage.png
%%QT_DOCDIR%%/qtdesigner/images/designer-tab-order-mode.png
%%QT_DOCDIR%%/qtdesigner/images/designer-tab-order-tool.png
%%QT_DOCDIR%%/qtdesigner/images/designer-widget-box.png
%%QT_DOCDIR%%/qtdesigner/images/designer-widget-morph.png
%%QT_DOCDIR%%/qtdesigner/images/designer-widget-tool.png
%%QT_DOCDIR%%/qtdesigner/images/directapproach-calculatorform.png
%%QT_DOCDIR%%/qtdesigner/images/home.png
%%QT_DOCDIR%%/qtdesigner/images/ico_note.png
%%QT_DOCDIR%%/qtdesigner/images/ico_note_attention.png
%%QT_DOCDIR%%/qtdesigner/images/ico_out.png
%%QT_DOCDIR%%/qtdesigner/images/logo.png
%%QT_DOCDIR%%/qtdesigner/images/qtdesignerextensions.png
%%QT_DOCDIR%%/qtdesigner/images/qtdesignerscreenshot.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-arrangement.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-configure-connection1.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-configure-connection2.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-final-layout.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-form-gridLayout.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-no-toplevel-layout.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-property-editing.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-screenshot.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-selectForLayout.png
%%QT_DOCDIR%%/qtdesigner/images/rgbController-signalsAndSlots.png
%%QT_DOCDIR%%/qtdesigner/images/taskmenuextension-dialog.png
%%QT_DOCDIR%%/qtdesigner/images/taskmenuextension-example-faded.png
%%QT_DOCDIR%%/qtdesigner/images/taskmenuextension-menu.png
%%QT_DOCDIR%%/qtdesigner/images/worldtimeclock-connection.png
%%QT_DOCDIR%%/qtdesigner/images/worldtimeclock-signalandslot.png
%%QT_DOCDIR%%/qtdesigner/images/worldtimeclockbuilder-example.png
%%QT_DOCDIR%%/qtdesigner/images/worldtimeclockplugin-example.png
%%QT_DOCDIR%%/qtdesigner/qabstractextensionfactory-members.html
%%QT_DOCDIR%%/qtdesigner/qabstractextensionfactory.html
%%QT_DOCDIR%%/qtdesigner/qabstractextensionmanager-members.html
%%QT_DOCDIR%%/qtdesigner/qabstractextensionmanager.html
%%QT_DOCDIR%%/qtdesigner/qabstractformbuilder-members.html
%%QT_DOCDIR%%/qtdesigner/qabstractformbuilder.html
%%QT_DOCDIR%%/qtdesigner/qdesigneractioneditorinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesigneractioneditorinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignercontainerextension-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignercontainerextension.html
%%QT_DOCDIR%%/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignercustomwidgetcollectioninterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignercustomwidgetinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignercustomwidgetinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerdynamicpropertysheetextension.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformeditorinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformeditorinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowcursorinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowcursorinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowmanagerinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
%%QT_DOCDIR%%/qtdesigner/qdesignerformwindowmanagerinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignermembersheetextension-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignermembersheetextension.html
%%QT_DOCDIR%%/qtdesigner/qdesignerobjectinspectorinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerobjectinspectorinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerpropertyeditorinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerpropertyeditorinterface.html
%%QT_DOCDIR%%/qtdesigner/qdesignerpropertysheetextension-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerpropertysheetextension.html
%%QT_DOCDIR%%/qtdesigner/qdesignertaskmenuextension-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignertaskmenuextension.html
%%QT_DOCDIR%%/qtdesigner/qdesignerwidgetboxinterface-members.html
%%QT_DOCDIR%%/qtdesigner/qdesignerwidgetboxinterface.html
%%QT_DOCDIR%%/qtdesigner/qextensionfactory-members.html
%%QT_DOCDIR%%/qtdesigner/qextensionfactory.html
%%QT_DOCDIR%%/qtdesigner/qextensionmanager-members.html
%%QT_DOCDIR%%/qtdesigner/qextensionmanager.html
%%QT_DOCDIR%%/qtdesigner/qformbuilder-members.html
%%QT_DOCDIR%%/qtdesigner/qformbuilder.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-ui.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorbuilder-main-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-calculatorform-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-calculatorform-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-calculatorform-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-calculatorform-ui.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-calculatorform-main-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-components.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-containerextension-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidget-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidget-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-analogclock-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-analogclock-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-customwidgetplugin-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-index.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-manual.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-module.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-taskmenuextension-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoe-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoe-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockbuilder-form-ui.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockbuilder-main-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
%%QT_DOCDIR%%/qtdesigner/qtdesigner.index
%%QT_DOCDIR%%/qtdesigner/qtdesigner.qhp
%%QT_DOCDIR%%/qtdesigner/qtdesigner.qhp.sha1
%%QT_DOCDIR%%/qtdesigner/style/offline-simple.css
%%QT_DOCDIR%%/qtdesigner/style/offline.css
%%QT_DOCDIR%%/qtdoc.qch
%%QT_DOCDIR%%/qtdoc/3rdparty.html
%%QT_DOCDIR%%/qtdoc/accelerators.html
%%QT_DOCDIR%%/qtdoc/accessibility.html
%%QT_DOCDIR%%/qtdoc/accessible-qtquick.html
%%QT_DOCDIR%%/qtdoc/accessible-qwidget.html
%%QT_DOCDIR%%/qtdoc/accessible.html
%%QT_DOCDIR%%/qtdoc/activeqt-idc.html
%%QT_DOCDIR%%/qtdoc/activeqt-testcon.html
%%QT_DOCDIR%%/qtdoc/all-examples.html
%%QT_DOCDIR%%/qtdoc/android-runtime-licensing-notes.html
%%QT_DOCDIR%%/qtdoc/android-support.html
%%QT_DOCDIR%%/qtdoc/android3rdpartylibs.html
%%QT_DOCDIR%%/qtdoc/androidgs.html
%%QT_DOCDIR%%/qtdoc/androidservices.html
%%QT_DOCDIR%%/qtdoc/annotated.html
%%QT_DOCDIR%%/qtdoc/appicon.html
%%QT_DOCDIR%%/qtdoc/atomic-operations.html
%%QT_DOCDIR%%/qtdoc/best-practices.html
%%QT_DOCDIR%%/qtdoc/bughowto.html
%%QT_DOCDIR%%/qtdoc/build-sources.html
%%QT_DOCDIR%%/qtdoc/building-from-source-ios.html
%%QT_DOCDIR%%/qtdoc/classes.html
%%QT_DOCDIR%%/qtdoc/classesandfunctions.html
%%QT_DOCDIR%%/qtdoc/cmake-manual.html
%%QT_DOCDIR%%/qtdoc/commerciallicense.html
%%QT_DOCDIR%%/qtdoc/configure-options.html
%%QT_DOCDIR%%/qtdoc/debug.html
%%QT_DOCDIR%%/qtdoc/deployment-android.html
%%QT_DOCDIR%%/qtdoc/deployment-plugins.html
%%QT_DOCDIR%%/qtdoc/deployment.html
%%QT_DOCDIR%%/qtdoc/desktop-integration.html
%%QT_DOCDIR%%/qtdoc/embedded-linux.html
%%QT_DOCDIR%%/qtdoc/examples-activeqt.html
%%QT_DOCDIR%%/qtdoc/examples-android.html
%%QT_DOCDIR%%/qtdoc/examples-animation.html
%%QT_DOCDIR%%/qtdoc/examples-draganddrop.html
%%QT_DOCDIR%%/qtdoc/examples-gestures.html
%%QT_DOCDIR%%/qtdoc/examples-ios.html
%%QT_DOCDIR%%/qtdoc/examples-ipc.html
%%QT_DOCDIR%%/qtdoc/examples-layouts.html
%%QT_DOCDIR%%/qtdoc/examples-sql.html
%%QT_DOCDIR%%/qtdoc/examples-statemachine.html
%%QT_DOCDIR%%/qtdoc/examples-threadandconcurrent.html
%%QT_DOCDIR%%/qtdoc/examples-widgets-tools.html
%%QT_DOCDIR%%/qtdoc/examples-xml.html
%%QT_DOCDIR%%/qtdoc/exceptionsafety.html
%%QT_DOCDIR%%/qtdoc/fdl.html
%%QT_DOCDIR%%/qtdoc/functions.html
%%QT_DOCDIR%%/qtdoc/gettingstarted.html
%%QT_DOCDIR%%/qtdoc/gettingstartedqml.html
%%QT_DOCDIR%%/qtdoc/gettingstartedqt.html
%%QT_DOCDIR%%/qtdoc/gpl.html
%%QT_DOCDIR%%/qtdoc/groups.html
%%QT_DOCDIR%%/qtdoc/hierarchy.html
%%QT_DOCDIR%%/qtdoc/highdpi.html
%%QT_DOCDIR%%/qtdoc/i18n-plural-rules.html
%%QT_DOCDIR%%/qtdoc/i18n-source-translation.html
%%QT_DOCDIR%%/qtdoc/i18n.html
%%QT_DOCDIR%%/qtdoc/images/accessibleobjecttree.png
%%QT_DOCDIR%%/qtdoc/images/activeqt-examples.png
%%QT_DOCDIR%%/qtdoc/images/animatedtiles_snapshot.png
%%QT_DOCDIR%%/qtdoc/images/animation-examples.png
%%QT_DOCDIR%%/qtdoc/images/applicationwindow.png
%%QT_DOCDIR%%/qtdoc/images/arrow_bc.png
%%QT_DOCDIR%%/qtdoc/images/bgrContent.png
%%QT_DOCDIR%%/qtdoc/images/btn_next.png
%%QT_DOCDIR%%/qtdoc/images/btn_prev.png
%%QT_DOCDIR%%/qtdoc/images/bullet_dn.png
%%QT_DOCDIR%%/qtdoc/images/bullet_sq.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_designer.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_main.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_navigator.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_newproperties.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_openproperties.png
%%QT_DOCDIR%%/qtdoc/images/controlstexteditor_rowproperties.png
%%QT_DOCDIR%%/qtdoc/images/deployment-mac-application.png
%%QT_DOCDIR%%/qtdoc/images/deployment-mac-bundlestructure.png
%%QT_DOCDIR%%/qtdoc/images/deployment-windows-depends.png
%%QT_DOCDIR%%/qtdoc/images/draganddrop-examples.png
%%QT_DOCDIR%%/qtdoc/images/flickr_application.png
%%QT_DOCDIR%%/qtdoc/images/gs-project1.png
%%QT_DOCDIR%%/qtdoc/images/gs-project2.png
%%QT_DOCDIR%%/qtdoc/images/gs1.png
%%QT_DOCDIR%%/qtdoc/images/gs2.png
%%QT_DOCDIR%%/qtdoc/images/gs3.png
%%QT_DOCDIR%%/qtdoc/images/gs4.png
%%QT_DOCDIR%%/qtdoc/images/gs5.png
%%QT_DOCDIR%%/qtdoc/images/home.png
%%QT_DOCDIR%%/qtdoc/images/ico_note.png
%%QT_DOCDIR%%/qtdoc/images/ico_note_attention.png
%%QT_DOCDIR%%/qtdoc/images/ico_out.png
%%QT_DOCDIR%%/qtdoc/images/icon_QtCreator_78x78px.png
%%QT_DOCDIR%%/qtdoc/images/icon_Qt_78x78px.png
%%QT_DOCDIR%%/qtdoc/images/icon_Tools.png
%%QT_DOCDIR%%/qtdoc/images/layout-examples.png
%%QT_DOCDIR%%/qtdoc/images/logo.png
%%QT_DOCDIR%%/qtdoc/images/qml-extending-types.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor1_button.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor1_editmenu.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor1_filemenu.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor1_simplebutton.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor2_menubar.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor3_texteditor.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor4_texteditor.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor5_editmenu.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor5_filemenu.png
%%QT_DOCDIR%%/qtdoc/images/qml-texteditor5_newfile.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-animation.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-integratingjs.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-layouts-anchors.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-layouts-direct.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-layouts-positioners.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-text.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-visual-opacity.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-visual-rectangles.png
%%QT_DOCDIR%%/qtdoc/images/qml-uses-visual-transforms.png
%%QT_DOCDIR%%/qtdoc/images/qt-codesample.png
%%QT_DOCDIR%%/qtdoc/images/qt-creator-gs.png
%%QT_DOCDIR%%/qtdoc/images/qt-embedded-fontfeatures.png
%%QT_DOCDIR%%/qtdoc/images/qt5_everywhere_demo.jpg
%%QT_DOCDIR%%/qtdoc/images/qt5_graphicaleffects.jpg
%%QT_DOCDIR%%/qtdoc/images/qt5_particles.jpg
%%QT_DOCDIR%%/qtdoc/images/qt5_shadereffect.jpg
%%QT_DOCDIR%%/qtdoc/images/qt5_video.jpg
%%QT_DOCDIR%%/qtdoc/images/qt5_widgets.jpg
%%QT_DOCDIR%%/qtdoc/images/qtcreator-run.png
%%QT_DOCDIR%%/qtdoc/images/qtlocation-mapviewer-demo.jpg
%%QT_DOCDIR%%/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
%%QT_DOCDIR%%/qtdoc/images/qtquickcontrols-example-gallery-android.png
%%QT_DOCDIR%%/qtdoc/images/qtquickcontrols-example-gallery-osx.png
%%QT_DOCDIR%%/qtdoc/images/qtsensors_accelbubble_ex.jpg
%%QT_DOCDIR%%/qtdoc/images/qtwebengine_quicknanobrowser.jpg
%%QT_DOCDIR%%/qtdoc/images/scalability-gridlayout.png
%%QT_DOCDIR%%/qtdoc/images/session.png
%%QT_DOCDIR%%/qtdoc/images/sql-examples.png
%%QT_DOCDIR%%/qtdoc/images/thread-examples.png
%%QT_DOCDIR%%/qtdoc/images/threadsandobjects.png
%%QT_DOCDIR%%/qtdoc/images/threadvisual-example.png
%%QT_DOCDIR%%/qtdoc/images/tool-examples.png
%%QT_DOCDIR%%/qtdoc/images/xml-examples.png
%%QT_DOCDIR%%/qtdoc/index.html
%%QT_DOCDIR%%/qtdoc/internationalization.html
%%QT_DOCDIR%%/qtdoc/ios-support.html
%%QT_DOCDIR%%/qtdoc/ipc.html
%%QT_DOCDIR%%/qtdoc/known-issues.html
%%QT_DOCDIR%%/qtdoc/lgpl.html
%%QT_DOCDIR%%/qtdoc/licenses-fonts.html
%%QT_DOCDIR%%/qtdoc/licenses.html
%%QT_DOCDIR%%/qtdoc/licensing.html
%%QT_DOCDIR%%/qtdoc/linux-building.html
%%QT_DOCDIR%%/qtdoc/linux-deployment.html
%%QT_DOCDIR%%/qtdoc/linux-issues.html
%%QT_DOCDIR%%/qtdoc/linux-requirements.html
%%QT_DOCDIR%%/qtdoc/linux.html
%%QT_DOCDIR%%/qtdoc/mac-licensing.html
%%QT_DOCDIR%%/qtdoc/mobiledevelopment.html
%%QT_DOCDIR%%/qtdoc/moc.html
%%QT_DOCDIR%%/qtdoc/modules-cpp.html
%%QT_DOCDIR%%/qtdoc/modules-qml.html
%%QT_DOCDIR%%/qtdoc/modules.html
%%QT_DOCDIR%%/qtdoc/namespaces.html
%%QT_DOCDIR%%/qtdoc/newclasses51.html
%%QT_DOCDIR%%/qtdoc/newclasses52.html
%%QT_DOCDIR%%/qtdoc/newclasses53.html
%%QT_DOCDIR%%/qtdoc/newclasses54.html
%%QT_DOCDIR%%/qtdoc/newclasses55.html
%%QT_DOCDIR%%/qtdoc/newclasses56.html
%%QT_DOCDIR%%/qtdoc/newclasses57.html
%%QT_DOCDIR%%/qtdoc/obsoleteclasses.html
%%QT_DOCDIR%%/qtdoc/obsoleteqmltypes.html
%%QT_DOCDIR%%/qtdoc/opensourcelicense.html
%%QT_DOCDIR%%/qtdoc/opensslsupport.html
%%QT_DOCDIR%%/qtdoc/osx-building.html
%%QT_DOCDIR%%/qtdoc/osx-deployment.html
%%QT_DOCDIR%%/qtdoc/osx-issues.html
%%QT_DOCDIR%%/qtdoc/osx-requirements.html
%%QT_DOCDIR%%/qtdoc/osx.html
%%QT_DOCDIR%%/qtdoc/overviews-main.html
%%QT_DOCDIR%%/qtdoc/overviews.html
%%QT_DOCDIR%%/qtdoc/platform-notes-android.html
%%QT_DOCDIR%%/qtdoc/platform-notes-integrity.html
%%QT_DOCDIR%%/qtdoc/platform-notes-ios.html
%%QT_DOCDIR%%/qtdoc/platform-notes-qnx.html
%%QT_DOCDIR%%/qtdoc/platform-notes-vxworks.html
%%QT_DOCDIR%%/qtdoc/plugins-howto.html
%%QT_DOCDIR%%/qtdoc/porting-to-ios.html
%%QT_DOCDIR%%/qtdoc/portingcppapp.html
%%QT_DOCDIR%%/qtdoc/portingguide.html
%%QT_DOCDIR%%/qtdoc/portingqmlapp.html
%%QT_DOCDIR%%/qtdoc/portingtoandroid.html
%%QT_DOCDIR%%/qtdoc/publishtogoogleplay.html
%%QT_DOCDIR%%/qtdoc/qml-codingconventions.html
%%QT_DOCDIR%%/qtdoc/qml-glossary.html
%%QT_DOCDIR%%/qtdoc/qmlapplications.html
%%QT_DOCDIR%%/qtdoc/qmlbasictypes.html
%%QT_DOCDIR%%/qtdoc/qmlfirststeps.html
%%QT_DOCDIR%%/qtdoc/qmltypes.html
%%QT_DOCDIR%%/qtdoc/qpa.html
%%QT_DOCDIR%%/qtdoc/qt-activex.html
%%QT_DOCDIR%%/qtdoc/qt-conf.html
%%QT_DOCDIR%%/qtdoc/qt-embedded-fonts.html
%%QT_DOCDIR%%/qtdoc/qt-embedded-kmap2qmap.html
%%QT_DOCDIR%%/qtdoc/qt-embedded-makeqpf.html
%%QT_DOCDIR%%/qtdoc/qt-gui-concepts.html
%%QT_DOCDIR%%/qtdoc/qt5-intro.html
%%QT_DOCDIR%%/qtdoc/qtconcurrent-mtexamples.html
%%QT_DOCDIR%%/qtdoc/qtconcurrentexamples.html
%%QT_DOCDIR%%/qtdoc/qtdoc.index
%%QT_DOCDIR%%/qtdoc/qtdoc.qhp
%%QT_DOCDIR%%/qtdoc/qtdoc.qhp.sha1
%%QT_DOCDIR%%/qtdoc/qtexamples.html
%%QT_DOCDIR%%/qtdoc/qtexamplesandtutorials.html
%%QT_DOCDIR%%/qtdoc/qtmain.html
%%QT_DOCDIR%%/qtdoc/qtmodules.html
%%QT_DOCDIR%%/qtdoc/qtquick-debugging.html
%%QT_DOCDIR%%/qtdoc/qtquick-deployment.html
%%QT_DOCDIR%%/qtdoc/qtquick-internationalization.html
%%QT_DOCDIR%%/qtdoc/qtquick-performance.html
%%QT_DOCDIR%%/qtdoc/qtquick-porting-qt5.html
%%QT_DOCDIR%%/qtdoc/qtquick-qmlscene.html
%%QT_DOCDIR%%/qtdoc/qtquick-qtquicktest.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-animations.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-integratingjs.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-layouts.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-styling.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-text.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-userinput.html
%%QT_DOCDIR%%/qtdoc/qtquick-usecase-visual.html
%%QT_DOCDIR%%/qtdoc/qtquickcontrols-texteditor-action.html
%%QT_DOCDIR%%/qtdoc/qtquickcontrols-texteditor-logic.html
%%QT_DOCDIR%%/qtdoc/qtquickcontrols-texteditor-ui.html
%%QT_DOCDIR%%/qtdoc/qtquickcontrols-texteditor.html
%%QT_DOCDIR%%/qtdoc/qundo.html
%%QT_DOCDIR%%/qtdoc/rcc.html
%%QT_DOCDIR%%/qtdoc/reference-overview.html
%%QT_DOCDIR%%/qtdoc/restoring-geometry.html
%%QT_DOCDIR%%/qtdoc/scalability.html
%%QT_DOCDIR%%/qtdoc/session.html
%%QT_DOCDIR%%/qtdoc/sharedlibrary.html
%%QT_DOCDIR%%/qtdoc/signalsandslots-syntaxes.html
%%QT_DOCDIR%%/qtdoc/sourcebreaks.html
%%QT_DOCDIR%%/qtdoc/sql-examples.html
%%QT_DOCDIR%%/qtdoc/string-processing.html
%%QT_DOCDIR%%/qtdoc/style/offline-simple.css
%%QT_DOCDIR%%/qtdoc/style/offline.css
%%QT_DOCDIR%%/qtdoc/style/qt5-sidebar.html
%%QT_DOCDIR%%/qtdoc/supported-platforms-and-configurations.html
%%QT_DOCDIR%%/qtdoc/supported-platforms.html
%%QT_DOCDIR%%/qtdoc/testing-and-debugging.html
%%QT_DOCDIR%%/qtdoc/third-party-libraries.html
%%QT_DOCDIR%%/qtdoc/thread-basics.html
%%QT_DOCDIR%%/qtdoc/thread.html
%%QT_DOCDIR%%/qtdoc/threads-modules.html
%%QT_DOCDIR%%/qtdoc/threads-qobject.html
%%QT_DOCDIR%%/qtdoc/threads-reentrancy.html
%%QT_DOCDIR%%/qtdoc/threads-synchronizing.html
%%QT_DOCDIR%%/qtdoc/threads-technologies.html
%%QT_DOCDIR%%/qtdoc/threads.html
%%QT_DOCDIR%%/qtdoc/topics-app-development.html
%%QT_DOCDIR%%/qtdoc/topics-core.html
%%QT_DOCDIR%%/qtdoc/topics-data-storage.html
%%QT_DOCDIR%%/qtdoc/topics-graphics.html
%%QT_DOCDIR%%/qtdoc/topics-network-connectivity.html
%%QT_DOCDIR%%/qtdoc/topics-scripting.html
%%QT_DOCDIR%%/qtdoc/topics-ui.html
%%QT_DOCDIR%%/qtdoc/topics-web-content.html
%%QT_DOCDIR%%/qtdoc/touchinputexamples.html
%%QT_DOCDIR%%/qtdoc/trademarks.html
%%QT_DOCDIR%%/qtdoc/uic.html
%%QT_DOCDIR%%/qtdoc/unicode.html
%%QT_DOCDIR%%/qtdoc/unix-signals.html
%%QT_DOCDIR%%/qtdoc/whatsnew50.html
%%QT_DOCDIR%%/qtdoc/whatsnew51.html
%%QT_DOCDIR%%/qtdoc/whatsnew52.html
%%QT_DOCDIR%%/qtdoc/whatsnew53.html
%%QT_DOCDIR%%/qtdoc/whatsnew54.html
%%QT_DOCDIR%%/qtdoc/whatsnew55.html
%%QT_DOCDIR%%/qtdoc/whatsnew56.html
%%QT_DOCDIR%%/qtdoc/whatsnew57.html
%%QT_DOCDIR%%/qtdoc/why-moc.html
%%QT_DOCDIR%%/qtdoc/windows-building.html
%%QT_DOCDIR%%/qtdoc/windows-deployment.html
%%QT_DOCDIR%%/qtdoc/windows-issues.html
%%QT_DOCDIR%%/qtdoc/windows-requirements.html
%%QT_DOCDIR%%/qtdoc/windows-support.html
%%QT_DOCDIR%%/qtdoc/winrt-support.html
%%QT_DOCDIR%%/qtdoc/xml-examples.html
%%QT_DOCDIR%%/qtgamepad.qch
%%QT_DOCDIR%%/qtgamepad/examples-manifest.xml
%%QT_DOCDIR%%/qtgamepad/images/arrow_bc.png
%%QT_DOCDIR%%/qtgamepad/images/bgrContent.png
%%QT_DOCDIR%%/qtgamepad/images/btn_next.png
%%QT_DOCDIR%%/qtgamepad/images/btn_prev.png
%%QT_DOCDIR%%/qtgamepad/images/bullet_dn.png
%%QT_DOCDIR%%/qtgamepad/images/bullet_sq.png
%%QT_DOCDIR%%/qtgamepad/images/configuregamepadbuttons-example.png
%%QT_DOCDIR%%/qtgamepad/images/home.png
%%QT_DOCDIR%%/qtgamepad/images/ico_note.png
%%QT_DOCDIR%%/qtgamepad/images/ico_note_attention.png
%%QT_DOCDIR%%/qtgamepad/images/ico_out.png
%%QT_DOCDIR%%/qtgamepad/images/keynavigationgamepad-example.png
%%QT_DOCDIR%%/qtgamepad/images/logo.png
%%QT_DOCDIR%%/qtgamepad/images/qtquickgamepad-example.png
%%QT_DOCDIR%%/qtgamepad/qgamepad-members.html
%%QT_DOCDIR%%/qtgamepad/qgamepad.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-configurebuttons-pro.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-example.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-main-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-main-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-configurebuttons-qml-qrc.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-examples.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-index.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-keynavigation-example.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-keynavigation-keynavigation-pro.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-keynavigation-main-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-keynavigation-qml-main-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-keynavigation-qml-qrc.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-module.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-mouseitem-example.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-mouseitem-main-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-mouseitem-mouseitem-pro.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-mouseitem-qml-main-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-mouseitem-qml-qrc.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-qmlmodule.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-example.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-main-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-buttonimage-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-dpad-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-joystickviewer-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-main-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-qrc.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-quickgamepad-quickgamepad-pro.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-example.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-gamepadmonitor-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-gamepadmonitor-h.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-main-cpp.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad-simple-simple-pro.html
%%QT_DOCDIR%%/qtgamepad/qtgamepad.index
%%QT_DOCDIR%%/qtgamepad/qtgamepad.qhp
%%QT_DOCDIR%%/qtgamepad/qtgamepad.qhp.sha1
%%QT_DOCDIR%%/qtgamepad/style/offline-simple.css
%%QT_DOCDIR%%/qtgamepad/style/offline.css
%%QT_DOCDIR%%/qtgraphicaleffects.qch
%%QT_DOCDIR%%/qtgraphicaleffects/graphicaleffects.html
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode10.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode11.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode12.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode13.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode14.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode15.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode16.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode17.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode18.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode19.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode20.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode21.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode22.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode4.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode5.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode6.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode7.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode8.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Blend_mode9.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ColorOverlay_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ColorOverlay_color1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ColorOverlay_color2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ColorOverlay_color3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_hue1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_hue2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_hue3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_hue_scale.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_lightness1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_lightness2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_lightness3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_saturation1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_saturation2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Colorize_saturation3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_angle1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_angle2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_angle3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_gradient1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_gradient2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_gradient3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Desaturate_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Desaturate_desaturation1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Desaturate_desaturation2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Desaturate_desaturation3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_angle1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_angle2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_angle3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_length1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_length2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DirectionalBlur_length3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Displace_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Displace_displacement1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Displace_displacement2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Displace_displacement3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Displace_map.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow-transparentBorder.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_color1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_color2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_color3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_spread1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_spread2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/DropShadow_spread3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_deviation1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_deviation2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_deviation3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow-transparentBorder.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_color1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_color2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_color3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_spread1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_spread2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Glow_spread3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_hue1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_hue2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_hue3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_lightness1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_lightness2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_lightness3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_saturation1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_saturation2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/HueSaturation_saturation3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_color1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_color2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_color3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_fast1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_fast2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_spread1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_spread2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/InnerShadow_spread3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_default_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_gamma1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_gamma2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_gamma3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_end1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_end2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_end3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_gradient1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_gradient2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_gradient3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_maskSource1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_maskSource2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_start1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_start2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/LinearGradient_start3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/MaskedBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/MaskedBlur_mask.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/MaskedBlur_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/MaskedBlur_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/MaskedBlur_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/OpacityMask_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/OpacityMask_mask.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Original_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Original_butterfly.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/Original_butterfly_black.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_angle1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_angle2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_angle3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_angle1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_angle2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_angle3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_gradient1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_gradient2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_gradient3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_maskSource1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RadialGradient_maskSource2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_applied.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_color1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_color2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_color3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_spread1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_spread2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RectangularGlow_spread3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_loops1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_loops2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_loops3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_radius1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_radius2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_radius3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_mask.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_spread1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_spread2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_spread3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_threshold1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_threshold2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ThresholdMask_threshold3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_bug.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_length1.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_length2.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ZoomBlur_length3.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/arrow_bc.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/bgrContent.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/btn_next.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/btn_prev.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/bullet_dn.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/bullet_sq.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/home.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ico_note.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ico_note_attention.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/ico_out.png
%%QT_DOCDIR%%/qtgraphicaleffects/images/logo.png
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
%%QT_DOCDIR%%/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects-index.html
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects.index
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects.qhp
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
%%QT_DOCDIR%%/qtgraphicaleffects/qtgraphicaleffects.tags
%%QT_DOCDIR%%/qtgraphicaleffects/style/offline-simple.css
%%QT_DOCDIR%%/qtgraphicaleffects/style/offline.css
%%QT_DOCDIR%%/qtgui.qch
%%QT_DOCDIR%%/qtgui/coordsys.html
%%QT_DOCDIR%%/qtgui/dnd.html
%%QT_DOCDIR%%/qtgui/examples-manifest.xml
%%QT_DOCDIR%%/qtgui/images/alphafill.png
%%QT_DOCDIR%%/qtgui/images/analogclock-window-example.png
%%QT_DOCDIR%%/qtgui/images/analogclockwindow-viewport.png
%%QT_DOCDIR%%/qtgui/images/arrow_bc.png
%%QT_DOCDIR%%/qtgui/images/bearings.png
%%QT_DOCDIR%%/qtgui/images/bgrContent.png
%%QT_DOCDIR%%/qtgui/images/brush-outline.png
%%QT_DOCDIR%%/qtgui/images/brush-styles.png
%%QT_DOCDIR%%/qtgui/images/btn_next.png
%%QT_DOCDIR%%/qtgui/images/btn_prev.png
%%QT_DOCDIR%%/qtgui/images/bullet_dn.png
%%QT_DOCDIR%%/qtgui/images/bullet_sq.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-analogclock.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-line-antialias.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-line-raster.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-line.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-rect-antialias.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-rect-raster.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-rect.png
%%QT_DOCDIR%%/qtgui/images/coordinatesystem-transformations.png
%%QT_DOCDIR%%/qtgui/images/cursor-arrow.png
%%QT_DOCDIR%%/qtgui/images/cursor-busy.png
%%QT_DOCDIR%%/qtgui/images/cursor-closedhand.png
%%QT_DOCDIR%%/qtgui/images/cursor-cross.png
%%QT_DOCDIR%%/qtgui/images/cursor-forbidden.png
%%QT_DOCDIR%%/qtgui/images/cursor-hand.png
%%QT_DOCDIR%%/qtgui/images/cursor-hsplit.png
%%QT_DOCDIR%%/qtgui/images/cursor-ibeam.png
%%QT_DOCDIR%%/qtgui/images/cursor-openhand.png
%%QT_DOCDIR%%/qtgui/images/cursor-sizeall.png
%%QT_DOCDIR%%/qtgui/images/cursor-sizeb.png
%%QT_DOCDIR%%/qtgui/images/cursor-sizef.png
%%QT_DOCDIR%%/qtgui/images/cursor-sizeh.png
%%QT_DOCDIR%%/qtgui/images/cursor-sizev.png
%%QT_DOCDIR%%/qtgui/images/cursor-uparrow.png
%%QT_DOCDIR%%/qtgui/images/cursor-vsplit.png
%%QT_DOCDIR%%/qtgui/images/cursor-wait.png
%%QT_DOCDIR%%/qtgui/images/cursor-whatsthis.png
%%QT_DOCDIR%%/qtgui/images/home.png
%%QT_DOCDIR%%/qtgui/images/hoverevents.png
%%QT_DOCDIR%%/qtgui/images/ico_note.png
%%QT_DOCDIR%%/qtgui/images/ico_note_attention.png
%%QT_DOCDIR%%/qtgui/images/ico_out.png
%%QT_DOCDIR%%/qtgui/images/icon.png
%%QT_DOCDIR%%/qtgui/images/logo.png
%%QT_DOCDIR%%/qtgui/images/openglwindow-example.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-antialiasing.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-core.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-fancygradient.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-gradients.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-movie.png
%%QT_DOCDIR%%/qtgui/images/paintsystem-painterpath.png
%%QT_DOCDIR%%/qtgui/images/palette.png
%%QT_DOCDIR%%/qtgui/images/plaintext-layout.png
%%QT_DOCDIR%%/qtgui/images/qcolor-cmyk.png
%%QT_DOCDIR%%/qtgui/images/qcolor-hsv.png
%%QT_DOCDIR%%/qtgui/images/qcolor-hue.png
%%QT_DOCDIR%%/qtgui/images/qcolor-rgb.png
%%QT_DOCDIR%%/qtgui/images/qcolor-saturation.png
%%QT_DOCDIR%%/qtgui/images/qcolor-value.png
%%QT_DOCDIR%%/qtgui/images/qconicalgradient.png
%%QT_DOCDIR%%/qtgui/images/qgradient-conical.png
%%QT_DOCDIR%%/qtgui/images/qgradient-linear.png
%%QT_DOCDIR%%/qtgui/images/qgradient-radial.png
%%QT_DOCDIR%%/qtgui/images/qimage-32bit_scaled.png
%%QT_DOCDIR%%/qtgui/images/qimage-8bit_scaled.png
%%QT_DOCDIR%%/qtgui/images/qimage-scaling.png
%%QT_DOCDIR%%/qtgui/images/qlineargradient-pad.png
%%QT_DOCDIR%%/qtgui/images/qlineargradient-reflect.png
%%QT_DOCDIR%%/qtgui/images/qlineargradient-repeat.png
%%QT_DOCDIR%%/qtgui/images/qmatrix-combinedtransformation.png
%%QT_DOCDIR%%/qtgui/images/qmatrix-representation.png
%%QT_DOCDIR%%/qtgui/images/qmatrix-simpletransformation.png
%%QT_DOCDIR%%/qtgui/images/qpainter-affinetransformations.png
%%QT_DOCDIR%%/qtgui/images/qpainter-arc.png
%%QT_DOCDIR%%/qtgui/images/qpainter-basicdrawing.png
%%QT_DOCDIR%%/qtgui/images/qpainter-chord.png
%%QT_DOCDIR%%/qtgui/images/qpainter-clock.png
%%QT_DOCDIR%%/qtgui/images/qpainter-compositiondemo.png
%%QT_DOCDIR%%/qtgui/images/qpainter-compositionmode1.png
%%QT_DOCDIR%%/qtgui/images/qpainter-compositionmode2.png
%%QT_DOCDIR%%/qtgui/images/qpainter-concentriccircles.png
%%QT_DOCDIR%%/qtgui/images/qpainter-ellipse.png
%%QT_DOCDIR%%/qtgui/images/qpainter-gradients.png
%%QT_DOCDIR%%/qtgui/images/qpainter-line.png
%%QT_DOCDIR%%/qtgui/images/qpainter-painterpaths.png
%%QT_DOCDIR%%/qtgui/images/qpainter-path.png
%%QT_DOCDIR%%/qtgui/images/qpainter-pathstroking.png
%%QT_DOCDIR%%/qtgui/images/qpainter-pie.png
%%QT_DOCDIR%%/qtgui/images/qpainter-polygon.png
%%QT_DOCDIR%%/qtgui/images/qpainter-rectangle.png
%%QT_DOCDIR%%/qtgui/images/qpainter-rotation.png
%%QT_DOCDIR%%/qtgui/images/qpainter-roundrect.png
%%QT_DOCDIR%%/qtgui/images/qpainter-scale.png
%%QT_DOCDIR%%/qtgui/images/qpainter-text-bounds.png
%%QT_DOCDIR%%/qtgui/images/qpainter-text.png
%%QT_DOCDIR%%/qtgui/images/qpainter-translation.png
%%QT_DOCDIR%%/qtgui/images/qpainter-vectordeformation.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-addellipse.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-addpolygon.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-addrectangle.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-addtext.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-arcto.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-construction.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-cubicto.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-demo.png
%%QT_DOCDIR%%/qtgui/images/qpainterpath-example.png
%%QT_DOCDIR%%/qtgui/images/qpen-bevel.png
%%QT_DOCDIR%%/qtgui/images/qpen-custom.png
%%QT_DOCDIR%%/qtgui/images/qpen-dash.png
%%QT_DOCDIR%%/qtgui/images/qpen-dashdot.png
%%QT_DOCDIR%%/qtgui/images/qpen-dashdotdot.png
%%QT_DOCDIR%%/qtgui/images/qpen-dashpattern.png
%%QT_DOCDIR%%/qtgui/images/qpen-demo.png
%%QT_DOCDIR%%/qtgui/images/qpen-dot.png
%%QT_DOCDIR%%/qtgui/images/qpen-flat.png
%%QT_DOCDIR%%/qtgui/images/qpen-miter.png
%%QT_DOCDIR%%/qtgui/images/qpen-miterlimit.png
%%QT_DOCDIR%%/qtgui/images/qpen-roundcap.png
%%QT_DOCDIR%%/qtgui/images/qpen-roundjoin.png
%%QT_DOCDIR%%/qtgui/images/qpen-solid.png
%%QT_DOCDIR%%/qtgui/images/qpen-square.png
%%QT_DOCDIR%%/qtgui/images/qpixelformat-argb32buffer.png
%%QT_DOCDIR%%/qtgui/images/qradialgradient-pad.png
%%QT_DOCDIR%%/qtgui/images/qradialgradient-reflect.png
%%QT_DOCDIR%%/qtgui/images/qradialgradient-repeat.png
%%QT_DOCDIR%%/qtgui/images/qrect-diagram-zero.png
%%QT_DOCDIR%%/qtgui/images/qrectf-diagram-one.png
%%QT_DOCDIR%%/qtgui/images/qrectf-diagram-three.png
%%QT_DOCDIR%%/qtgui/images/qrectf-diagram-two.png
%%QT_DOCDIR%%/qtgui/images/qstatustipevent-action.png
%%QT_DOCDIR%%/qtgui/images/qstatustipevent-widget.png
%%QT_DOCDIR%%/qtgui/images/qt-colors.png
%%QT_DOCDIR%%/qtgui/images/qt-fillrule-oddeven.png
%%QT_DOCDIR%%/qtgui/images/qt-fillrule-winding.png
%%QT_DOCDIR%%/qtgui/images/qtabletevent-tilt.png
%%QT_DOCDIR%%/qtgui/images/qtextblock-sequence.png
%%QT_DOCDIR%%/qtgui/images/qtextfragment-split.png
%%QT_DOCDIR%%/qtgui/images/qtextframe-style.png
%%QT_DOCDIR%%/qtgui/images/qtexttableformat-cell.png
%%QT_DOCDIR%%/qtgui/images/qtransform-combinedtransformation.png
%%QT_DOCDIR%%/qtgui/images/qtransform-combinedtransformation2.png
%%QT_DOCDIR%%/qtgui/images/qtransform-representation.png
%%QT_DOCDIR%%/qtgui/images/qtransform-simpletransformation.png
%%QT_DOCDIR%%/qtgui/images/richtext-document.png
%%QT_DOCDIR%%/qtgui/images/rintersect.png
%%QT_DOCDIR%%/qtgui/images/rsubtract.png
%%QT_DOCDIR%%/qtgui/images/runion.png
%%QT_DOCDIR%%/qtgui/images/rxor.png
%%QT_DOCDIR%%/qtgui/images/texttable-merge.png
%%QT_DOCDIR%%/qtgui/images/texttable-split.png
%%QT_DOCDIR%%/qtgui/painting-3d.html
%%QT_DOCDIR%%/qtgui/painting.html
%%QT_DOCDIR%%/qtgui/paintsystem-devices.html
%%QT_DOCDIR%%/qtgui/paintsystem-drawing.html
%%QT_DOCDIR%%/qtgui/paintsystem-images.html
%%QT_DOCDIR%%/qtgui/paintsystem.html
%%QT_DOCDIR%%/qtgui/qabstractopenglfunctions-members.html
%%QT_DOCDIR%%/qtgui/qabstractopenglfunctions.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout-members.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout-paintcontext.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout-selection-members.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout-selection.html
%%QT_DOCDIR%%/qtgui/qabstracttextdocumentlayout.html
%%QT_DOCDIR%%/qtgui/qaccessible-members.html
%%QT_DOCDIR%%/qtgui/qaccessible-obsolete.html
%%QT_DOCDIR%%/qtgui/qaccessible-state-members.html
%%QT_DOCDIR%%/qtgui/qaccessible-state.html
%%QT_DOCDIR%%/qtgui/qaccessible.html
%%QT_DOCDIR%%/qtgui/qaccessibleactioninterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleactioninterface.html
%%QT_DOCDIR%%/qtgui/qaccessibleeditabletextinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleeditabletextinterface.html
%%QT_DOCDIR%%/qtgui/qaccessibleevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleevent.html
%%QT_DOCDIR%%/qtgui/qaccessibleinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleinterface.html
%%QT_DOCDIR%%/qtgui/qaccessibleobject-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleobject.html
%%QT_DOCDIR%%/qtgui/qaccessibleplugin-members.html
%%QT_DOCDIR%%/qtgui/qaccessibleplugin.html
%%QT_DOCDIR%%/qtgui/qaccessiblestatechangeevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessiblestatechangeevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletablecellinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletablecellinterface.html
%%QT_DOCDIR%%/qtgui/qaccessibletableinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletableinterface.html
%%QT_DOCDIR%%/qtgui/qaccessibletablemodelchangeevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletablemodelchangeevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletextcursorevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextcursorevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletextinsertevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextinsertevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletextinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextinterface.html
%%QT_DOCDIR%%/qtgui/qaccessibletextremoveevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextremoveevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletextselectionevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextselectionevent.html
%%QT_DOCDIR%%/qtgui/qaccessibletextupdateevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessibletextupdateevent.html
%%QT_DOCDIR%%/qtgui/qaccessiblevaluechangeevent-members.html
%%QT_DOCDIR%%/qtgui/qaccessiblevaluechangeevent.html
%%QT_DOCDIR%%/qtgui/qaccessiblevalueinterface-members.html
%%QT_DOCDIR%%/qtgui/qaccessiblevalueinterface.html
%%QT_DOCDIR%%/qtgui/qactionevent-members.html
%%QT_DOCDIR%%/qtgui/qactionevent.html
%%QT_DOCDIR%%/qtgui/qbackingstore-members.html
%%QT_DOCDIR%%/qtgui/qbackingstore.html
%%QT_DOCDIR%%/qtgui/qbitmap-members.html
%%QT_DOCDIR%%/qtgui/qbitmap-obsolete.html
%%QT_DOCDIR%%/qtgui/qbitmap.html
%%QT_DOCDIR%%/qtgui/qbrush-members.html
%%QT_DOCDIR%%/qtgui/qbrush.html
%%QT_DOCDIR%%/qtgui/qclipboard-members.html
%%QT_DOCDIR%%/qtgui/qclipboard.html
%%QT_DOCDIR%%/qtgui/qcloseevent-members.html
%%QT_DOCDIR%%/qtgui/qcloseevent.html
%%QT_DOCDIR%%/qtgui/qcolor-members.html
%%QT_DOCDIR%%/qtgui/qcolor-obsolete.html
%%QT_DOCDIR%%/qtgui/qcolor.html
%%QT_DOCDIR%%/qtgui/qconicalgradient-members.html
%%QT_DOCDIR%%/qtgui/qconicalgradient.html
%%QT_DOCDIR%%/qtgui/qcontextmenuevent-members.html
%%QT_DOCDIR%%/qtgui/qcontextmenuevent.html
%%QT_DOCDIR%%/qtgui/qcursor-members.html
%%QT_DOCDIR%%/qtgui/qcursor.html
%%QT_DOCDIR%%/qtgui/qdesktopservices-members.html
%%QT_DOCDIR%%/qtgui/qdesktopservices-obsolete.html
%%QT_DOCDIR%%/qtgui/qdesktopservices.html
%%QT_DOCDIR%%/qtgui/qdoublevalidator-members.html
%%QT_DOCDIR%%/qtgui/qdoublevalidator.html
%%QT_DOCDIR%%/qtgui/qdrag-members.html
%%QT_DOCDIR%%/qtgui/qdrag-obsolete.html
%%QT_DOCDIR%%/qtgui/qdrag.html
%%QT_DOCDIR%%/qtgui/qdragenterevent-members.html
%%QT_DOCDIR%%/qtgui/qdragenterevent.html
%%QT_DOCDIR%%/qtgui/qdragleaveevent-members.html
%%QT_DOCDIR%%/qtgui/qdragleaveevent.html
%%QT_DOCDIR%%/qtgui/qdragmoveevent-members.html
%%QT_DOCDIR%%/qtgui/qdragmoveevent.html
%%QT_DOCDIR%%/qtgui/qdropevent-members.html
%%QT_DOCDIR%%/qtgui/qdropevent.html
%%QT_DOCDIR%%/qtgui/qenterevent-members.html
%%QT_DOCDIR%%/qtgui/qenterevent.html
%%QT_DOCDIR%%/qtgui/qexposeevent-members.html
%%QT_DOCDIR%%/qtgui/qexposeevent.html
%%QT_DOCDIR%%/qtgui/qfileopenevent-members.html
%%QT_DOCDIR%%/qtgui/qfileopenevent.html
%%QT_DOCDIR%%/qtgui/qfocusevent-members.html
%%QT_DOCDIR%%/qtgui/qfocusevent.html
%%QT_DOCDIR%%/qtgui/qfont-members.html
%%QT_DOCDIR%%/qtgui/qfont-obsolete.html
%%QT_DOCDIR%%/qtgui/qfont.html
%%QT_DOCDIR%%/qtgui/qfontdatabase-members.html
%%QT_DOCDIR%%/qtgui/qfontdatabase-obsolete.html
%%QT_DOCDIR%%/qtgui/qfontdatabase.html
%%QT_DOCDIR%%/qtgui/qfontinfo-members.html
%%QT_DOCDIR%%/qtgui/qfontinfo-obsolete.html
%%QT_DOCDIR%%/qtgui/qfontinfo.html
%%QT_DOCDIR%%/qtgui/qfontmetrics-members.html
%%QT_DOCDIR%%/qtgui/qfontmetrics-obsolete.html
%%QT_DOCDIR%%/qtgui/qfontmetrics.html
%%QT_DOCDIR%%/qtgui/qfontmetricsf-members.html
%%QT_DOCDIR%%/qtgui/qfontmetricsf.html
%%QT_DOCDIR%%/qtgui/qgenericmatrix-members.html
%%QT_DOCDIR%%/qtgui/qgenericmatrix.html
%%QT_DOCDIR%%/qtgui/qgenericplugin-members.html
%%QT_DOCDIR%%/qtgui/qgenericplugin.html
%%QT_DOCDIR%%/qtgui/qgenericpluginfactory-members.html
%%QT_DOCDIR%%/qtgui/qgenericpluginfactory.html
%%QT_DOCDIR%%/qtgui/qglyphrun-members.html
%%QT_DOCDIR%%/qtgui/qglyphrun.html
%%QT_DOCDIR%%/qtgui/qgradient-members.html
%%QT_DOCDIR%%/qtgui/qgradient.html
%%QT_DOCDIR%%/qtgui/qguiapplication-members.html
%%QT_DOCDIR%%/qtgui/qguiapplication.html
%%QT_DOCDIR%%/qtgui/qhelpevent-members.html
%%QT_DOCDIR%%/qtgui/qhelpevent.html
%%QT_DOCDIR%%/qtgui/qhideevent-members.html
%%QT_DOCDIR%%/qtgui/qhideevent.html
%%QT_DOCDIR%%/qtgui/qhoverevent-members.html
%%QT_DOCDIR%%/qtgui/qhoverevent.html
%%QT_DOCDIR%%/qtgui/qicon-members.html
%%QT_DOCDIR%%/qtgui/qicon-obsolete.html
%%QT_DOCDIR%%/qtgui/qicon.html
%%QT_DOCDIR%%/qtgui/qicondragevent-members.html
%%QT_DOCDIR%%/qtgui/qicondragevent.html
%%QT_DOCDIR%%/qtgui/qiconengine-availablesizesargument-members.html
%%QT_DOCDIR%%/qtgui/qiconengine-availablesizesargument.html
%%QT_DOCDIR%%/qtgui/qiconengine-members.html
%%QT_DOCDIR%%/qtgui/qiconengine.html
%%QT_DOCDIR%%/qtgui/qiconengineplugin-members.html
%%QT_DOCDIR%%/qtgui/qiconengineplugin.html
%%QT_DOCDIR%%/qtgui/qimage-members.html
%%QT_DOCDIR%%/qtgui/qimage-obsolete.html
%%QT_DOCDIR%%/qtgui/qimage.html
%%QT_DOCDIR%%/qtgui/qimageiohandler-members.html
%%QT_DOCDIR%%/qtgui/qimageiohandler-obsolete.html
%%QT_DOCDIR%%/qtgui/qimageiohandler.html
%%QT_DOCDIR%%/qtgui/qimageioplugin-members.html
%%QT_DOCDIR%%/qtgui/qimageioplugin.html
%%QT_DOCDIR%%/qtgui/qimagereader-members.html
%%QT_DOCDIR%%/qtgui/qimagereader.html
%%QT_DOCDIR%%/qtgui/qimagewriter-members.html
%%QT_DOCDIR%%/qtgui/qimagewriter-obsolete.html
%%QT_DOCDIR%%/qtgui/qimagewriter.html
%%QT_DOCDIR%%/qtgui/qinputevent-members.html
%%QT_DOCDIR%%/qtgui/qinputevent.html
%%QT_DOCDIR%%/qtgui/qinputmethod-members.html
%%QT_DOCDIR%%/qtgui/qinputmethod.html
%%QT_DOCDIR%%/qtgui/qinputmethodevent-attribute-members.html
%%QT_DOCDIR%%/qtgui/qinputmethodevent-attribute.html
%%QT_DOCDIR%%/qtgui/qinputmethodevent-members.html
%%QT_DOCDIR%%/qtgui/qinputmethodevent.html
%%QT_DOCDIR%%/qtgui/qinputmethodqueryevent-members.html
%%QT_DOCDIR%%/qtgui/qinputmethodqueryevent.html
%%QT_DOCDIR%%/qtgui/qintvalidator-members.html
%%QT_DOCDIR%%/qtgui/qintvalidator.html
%%QT_DOCDIR%%/qtgui/qkeyevent-members.html
%%QT_DOCDIR%%/qtgui/qkeyevent.html
%%QT_DOCDIR%%/qtgui/qkeysequence-members.html
%%QT_DOCDIR%%/qtgui/qkeysequence-obsolete.html
%%QT_DOCDIR%%/qtgui/qkeysequence.html
%%QT_DOCDIR%%/qtgui/qlineargradient-members.html
%%QT_DOCDIR%%/qtgui/qlineargradient.html
%%QT_DOCDIR%%/qtgui/qmatrix-members.html
%%QT_DOCDIR%%/qtgui/qmatrix.html
%%QT_DOCDIR%%/qtgui/qmatrix4x4-members.html
%%QT_DOCDIR%%/qtgui/qmatrix4x4-obsolete.html
%%QT_DOCDIR%%/qtgui/qmatrix4x4.html
%%QT_DOCDIR%%/qtgui/qmouseevent-members.html
%%QT_DOCDIR%%/qtgui/qmouseevent-obsolete.html
%%QT_DOCDIR%%/qtgui/qmouseevent.html
%%QT_DOCDIR%%/qtgui/qmoveevent-members.html
%%QT_DOCDIR%%/qtgui/qmoveevent.html
%%QT_DOCDIR%%/qtgui/qmovie-members.html
%%QT_DOCDIR%%/qtgui/qmovie.html
%%QT_DOCDIR%%/qtgui/qnativegestureevent-members.html
%%QT_DOCDIR%%/qtgui/qnativegestureevent.html
%%QT_DOCDIR%%/qtgui/qoffscreensurface-members.html
%%QT_DOCDIR%%/qtgui/qoffscreensurface.html
%%QT_DOCDIR%%/qtgui/qopenglbuffer-members.html
%%QT_DOCDIR%%/qtgui/qopenglbuffer.html
%%QT_DOCDIR%%/qtgui/qopenglcontext-members.html
%%QT_DOCDIR%%/qtgui/qopenglcontext.html
%%QT_DOCDIR%%/qtgui/qopenglcontextgroup-members.html
%%QT_DOCDIR%%/qtgui/qopenglcontextgroup.html
%%QT_DOCDIR%%/qtgui/qopengldebuglogger-members.html
%%QT_DOCDIR%%/qtgui/qopengldebuglogger.html
%%QT_DOCDIR%%/qtgui/qopengldebugmessage-members.html
%%QT_DOCDIR%%/qtgui/qopengldebugmessage.html
%%QT_DOCDIR%%/qtgui/qopenglextrafunctions-members.html
%%QT_DOCDIR%%/qtgui/qopenglextrafunctions.html
%%QT_DOCDIR%%/qtgui/qopenglframebufferobject-members.html
%%QT_DOCDIR%%/qtgui/qopenglframebufferobject.html
%%QT_DOCDIR%%/qtgui/qopenglframebufferobjectformat-members.html
%%QT_DOCDIR%%/qtgui/qopenglframebufferobjectformat.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-0-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-0.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-1-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-1.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-2-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-2.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-3-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-3.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-4-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-4.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-5-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-1-5.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-2-0-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-2-0.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-2-1-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-2-1.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-0-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-0.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-1-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-1.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-2-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-2-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-2-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-2-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-3-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-3-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-3-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-3-3-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-0-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-0-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-0-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-0-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-1-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-1-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-1-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-1-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-2-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-2-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-2-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-2-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-3-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-3-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-3-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-3-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-4-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-4-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-4-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-4-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-5-compatibility-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-5-compatibility.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-5-core-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-4-5-core.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-es2-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-es2.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-members.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions-obsolete.html
%%QT_DOCDIR%%/qtgui/qopenglfunctions.html
%%QT_DOCDIR%%/qtgui/qopenglpaintdevice-members.html
%%QT_DOCDIR%%/qtgui/qopenglpaintdevice.html
%%QT_DOCDIR%%/qtgui/qopenglpixeltransferoptions-members.html
%%QT_DOCDIR%%/qtgui/qopenglpixeltransferoptions.html
%%QT_DOCDIR%%/qtgui/qopenglshader-members.html
%%QT_DOCDIR%%/qtgui/qopenglshader.html
%%QT_DOCDIR%%/qtgui/qopenglshaderprogram-members.html
%%QT_DOCDIR%%/qtgui/qopenglshaderprogram.html
%%QT_DOCDIR%%/qtgui/qopengltexture-members.html
%%QT_DOCDIR%%/qtgui/qopengltexture-obsolete.html
%%QT_DOCDIR%%/qtgui/qopengltexture.html
%%QT_DOCDIR%%/qtgui/qopengltimemonitor-members.html
%%QT_DOCDIR%%/qtgui/qopengltimemonitor.html
%%QT_DOCDIR%%/qtgui/qopengltimerquery-members.html
%%QT_DOCDIR%%/qtgui/qopengltimerquery.html
%%QT_DOCDIR%%/qtgui/qopenglversionprofile-members.html
%%QT_DOCDIR%%/qtgui/qopenglversionprofile.html
%%QT_DOCDIR%%/qtgui/qopenglvertexarrayobject-binder-members.html
%%QT_DOCDIR%%/qtgui/qopenglvertexarrayobject-binder.html
%%QT_DOCDIR%%/qtgui/qopenglvertexarrayobject-members.html
%%QT_DOCDIR%%/qtgui/qopenglvertexarrayobject.html
%%QT_DOCDIR%%/qtgui/qopenglwindow-members.html
%%QT_DOCDIR%%/qtgui/qopenglwindow.html
%%QT_DOCDIR%%/qtgui/qpagedpaintdevice-margins-members.html
%%QT_DOCDIR%%/qtgui/qpagedpaintdevice-margins.html
%%QT_DOCDIR%%/qtgui/qpagedpaintdevice-members.html
%%QT_DOCDIR%%/qtgui/qpagedpaintdevice.html
%%QT_DOCDIR%%/qtgui/qpagelayout-members.html
%%QT_DOCDIR%%/qtgui/qpagelayout.html
%%QT_DOCDIR%%/qtgui/qpagesize-members.html
%%QT_DOCDIR%%/qtgui/qpagesize.html
%%QT_DOCDIR%%/qtgui/qpaintdevice-members.html
%%QT_DOCDIR%%/qtgui/qpaintdevice.html
%%QT_DOCDIR%%/qtgui/qpaintdevicewindow-members.html
%%QT_DOCDIR%%/qtgui/qpaintdevicewindow.html
%%QT_DOCDIR%%/qtgui/qpaintengine-members.html
%%QT_DOCDIR%%/qtgui/qpaintengine.html
%%QT_DOCDIR%%/qtgui/qpaintenginestate-members.html
%%QT_DOCDIR%%/qtgui/qpaintenginestate-obsolete.html
%%QT_DOCDIR%%/qtgui/qpaintenginestate.html
%%QT_DOCDIR%%/qtgui/qpainter-members.html
%%QT_DOCDIR%%/qtgui/qpainter-obsolete.html
%%QT_DOCDIR%%/qtgui/qpainter-pixmapfragment-members.html
%%QT_DOCDIR%%/qtgui/qpainter-pixmapfragment.html
%%QT_DOCDIR%%/qtgui/qpainter.html
%%QT_DOCDIR%%/qtgui/qpainterpath-element-members.html
%%QT_DOCDIR%%/qtgui/qpainterpath-element.html
%%QT_DOCDIR%%/qtgui/qpainterpath-members.html
%%QT_DOCDIR%%/qtgui/qpainterpath-obsolete.html
%%QT_DOCDIR%%/qtgui/qpainterpath.html
%%QT_DOCDIR%%/qtgui/qpainterpathstroker-members.html
%%QT_DOCDIR%%/qtgui/qpainterpathstroker.html
%%QT_DOCDIR%%/qtgui/qpaintevent-members.html
%%QT_DOCDIR%%/qtgui/qpaintevent.html
%%QT_DOCDIR%%/qtgui/qpalette-members.html
%%QT_DOCDIR%%/qtgui/qpalette-obsolete.html
%%QT_DOCDIR%%/qtgui/qpalette.html
%%QT_DOCDIR%%/qtgui/qpdfwriter-members.html
%%QT_DOCDIR%%/qtgui/qpdfwriter-obsolete.html
%%QT_DOCDIR%%/qtgui/qpdfwriter.html
%%QT_DOCDIR%%/qtgui/qpen-members.html
%%QT_DOCDIR%%/qtgui/qpen.html
%%QT_DOCDIR%%/qtgui/qpicture-members.html
%%QT_DOCDIR%%/qtgui/qpicture-obsolete.html
%%QT_DOCDIR%%/qtgui/qpicture.html
%%QT_DOCDIR%%/qtgui/qpictureformatplugin-members.html
%%QT_DOCDIR%%/qtgui/qpictureformatplugin.html
%%QT_DOCDIR%%/qtgui/qpictureio-members.html
%%QT_DOCDIR%%/qtgui/qpictureio.html
%%QT_DOCDIR%%/qtgui/qpixelformat-members.html
%%QT_DOCDIR%%/qtgui/qpixelformat.html
%%QT_DOCDIR%%/qtgui/qpixmap-members.html
%%QT_DOCDIR%%/qtgui/qpixmap-obsolete.html
%%QT_DOCDIR%%/qtgui/qpixmap.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-key-members.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-key.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-keydata-members.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-keydata.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-members.html
%%QT_DOCDIR%%/qtgui/qpixmapcache-obsolete.html
%%QT_DOCDIR%%/qtgui/qpixmapcache.html
%%QT_DOCDIR%%/qtgui/qplatformgraphicsbuffer-members.html
%%QT_DOCDIR%%/qtgui/qplatformgraphicsbuffer.html
%%QT_DOCDIR%%/qtgui/qplatformsurfaceevent-members.html
%%QT_DOCDIR%%/qtgui/qplatformsurfaceevent.html
%%QT_DOCDIR%%/qtgui/qplatformsystemtrayicon-members.html
%%QT_DOCDIR%%/qtgui/qplatformsystemtrayicon.html
%%QT_DOCDIR%%/qtgui/qpolygon-members.html
%%QT_DOCDIR%%/qtgui/qpolygon.html
%%QT_DOCDIR%%/qtgui/qpolygonf-members.html
%%QT_DOCDIR%%/qtgui/qpolygonf.html
%%QT_DOCDIR%%/qtgui/qquaternion-members.html
%%QT_DOCDIR%%/qtgui/qquaternion-obsolete.html
%%QT_DOCDIR%%/qtgui/qquaternion.html
%%QT_DOCDIR%%/qtgui/qradialgradient-members.html
%%QT_DOCDIR%%/qtgui/qradialgradient.html
%%QT_DOCDIR%%/qtgui/qrasterpaintengine-members.html
%%QT_DOCDIR%%/qtgui/qrasterpaintengine.html
%%QT_DOCDIR%%/qtgui/qrasterwindow-members.html
%%QT_DOCDIR%%/qtgui/qrasterwindow.html
%%QT_DOCDIR%%/qtgui/qrawfont-members.html
%%QT_DOCDIR%%/qtgui/qrawfont.html
%%QT_DOCDIR%%/qtgui/qregexpvalidator-members.html
%%QT_DOCDIR%%/qtgui/qregexpvalidator.html
%%QT_DOCDIR%%/qtgui/qregion-members.html
%%QT_DOCDIR%%/qtgui/qregion-obsolete.html
%%QT_DOCDIR%%/qtgui/qregion.html
%%QT_DOCDIR%%/qtgui/qregularexpressionvalidator-members.html
%%QT_DOCDIR%%/qtgui/qregularexpressionvalidator.html
%%QT_DOCDIR%%/qtgui/qresizeevent-members.html
%%QT_DOCDIR%%/qtgui/qresizeevent.html
%%QT_DOCDIR%%/qtgui/qrgba64-members.html
%%QT_DOCDIR%%/qtgui/qrgba64.html
%%QT_DOCDIR%%/qtgui/qscreen-members.html
%%QT_DOCDIR%%/qtgui/qscreen.html
%%QT_DOCDIR%%/qtgui/qscrollevent-members.html
%%QT_DOCDIR%%/qtgui/qscrollevent.html
%%QT_DOCDIR%%/qtgui/qscrollprepareevent-members.html
%%QT_DOCDIR%%/qtgui/qscrollprepareevent.html
%%QT_DOCDIR%%/qtgui/qsessionmanager-members.html
%%QT_DOCDIR%%/qtgui/qsessionmanager.html
%%QT_DOCDIR%%/qtgui/qshortcutevent-members.html
%%QT_DOCDIR%%/qtgui/qshortcutevent.html
%%QT_DOCDIR%%/qtgui/qshowevent-members.html
%%QT_DOCDIR%%/qtgui/qshowevent.html
%%QT_DOCDIR%%/qtgui/qstandarditem-members.html
%%QT_DOCDIR%%/qtgui/qstandarditem-obsolete.html
%%QT_DOCDIR%%/qtgui/qstandarditem.html
%%QT_DOCDIR%%/qtgui/qstandarditemmodel-members.html
%%QT_DOCDIR%%/qtgui/qstandarditemmodel.html
%%QT_DOCDIR%%/qtgui/qstatictext-members.html
%%QT_DOCDIR%%/qtgui/qstatictext.html
%%QT_DOCDIR%%/qtgui/qstatustipevent-members.html
%%QT_DOCDIR%%/qtgui/qstatustipevent.html
%%QT_DOCDIR%%/qtgui/qstylehints-members.html
%%QT_DOCDIR%%/qtgui/qstylehints.html
%%QT_DOCDIR%%/qtgui/qsupportedwritingsystems-members.html
%%QT_DOCDIR%%/qtgui/qsupportedwritingsystems.html
%%QT_DOCDIR%%/qtgui/qsurface-members.html
%%QT_DOCDIR%%/qtgui/qsurface.html
%%QT_DOCDIR%%/qtgui/qsurfaceformat-members.html
%%QT_DOCDIR%%/qtgui/qsurfaceformat-obsolete.html
%%QT_DOCDIR%%/qtgui/qsurfaceformat.html
%%QT_DOCDIR%%/qtgui/qsyntaxhighlighter-members.html
%%QT_DOCDIR%%/qtgui/qsyntaxhighlighter.html
%%QT_DOCDIR%%/qtgui/qtabletevent-members.html
%%QT_DOCDIR%%/qtgui/qtabletevent-obsolete.html
%%QT_DOCDIR%%/qtgui/qtabletevent.html
%%QT_DOCDIR%%/qtgui/qtextblock-iterator-members.html
%%QT_DOCDIR%%/qtgui/qtextblock-iterator.html
%%QT_DOCDIR%%/qtgui/qtextblock-members.html
%%QT_DOCDIR%%/qtgui/qtextblock.html
%%QT_DOCDIR%%/qtgui/qtextblockformat-members.html
%%QT_DOCDIR%%/qtgui/qtextblockformat.html
%%QT_DOCDIR%%/qtgui/qtextblockgroup-members.html
%%QT_DOCDIR%%/qtgui/qtextblockgroup.html
%%QT_DOCDIR%%/qtgui/qtextblockuserdata-members.html
%%QT_DOCDIR%%/qtgui/qtextblockuserdata.html
%%QT_DOCDIR%%/qtgui/qtextcharformat-members.html
%%QT_DOCDIR%%/qtgui/qtextcharformat-obsolete.html
%%QT_DOCDIR%%/qtgui/qtextcharformat.html
%%QT_DOCDIR%%/qtgui/qtextcursor-members.html
%%QT_DOCDIR%%/qtgui/qtextcursor.html
%%QT_DOCDIR%%/qtgui/qtextdocument-members.html
%%QT_DOCDIR%%/qtgui/qtextdocument.html
%%QT_DOCDIR%%/qtgui/qtextdocumentfragment-members.html
%%QT_DOCDIR%%/qtgui/qtextdocumentfragment.html
%%QT_DOCDIR%%/qtgui/qtextdocumentwriter-members.html
%%QT_DOCDIR%%/qtgui/qtextdocumentwriter.html
%%QT_DOCDIR%%/qtgui/qtextformat-members.html
%%QT_DOCDIR%%/qtgui/qtextformat.html
%%QT_DOCDIR%%/qtgui/qtextfragment-members.html
%%QT_DOCDIR%%/qtgui/qtextfragment.html
%%QT_DOCDIR%%/qtgui/qtextframe-iterator-members.html
%%QT_DOCDIR%%/qtgui/qtextframe-iterator.html
%%QT_DOCDIR%%/qtgui/qtextframe-members.html
%%QT_DOCDIR%%/qtgui/qtextframe.html
%%QT_DOCDIR%%/qtgui/qtextframeformat-members.html
%%QT_DOCDIR%%/qtgui/qtextframeformat.html
%%QT_DOCDIR%%/qtgui/qtextimageformat-members.html
%%QT_DOCDIR%%/qtgui/qtextimageformat.html
%%QT_DOCDIR%%/qtgui/qtextinlineobject-members.html
%%QT_DOCDIR%%/qtgui/qtextinlineobject.html
%%QT_DOCDIR%%/qtgui/qtextitem-members.html
%%QT_DOCDIR%%/qtgui/qtextitem.html
%%QT_DOCDIR%%/qtgui/qtextlayout-formatrange-members.html
%%QT_DOCDIR%%/qtgui/qtextlayout-formatrange.html
%%QT_DOCDIR%%/qtgui/qtextlayout-members.html
%%QT_DOCDIR%%/qtgui/qtextlayout-obsolete.html
%%QT_DOCDIR%%/qtgui/qtextlayout.html
%%QT_DOCDIR%%/qtgui/qtextlength-members.html
%%QT_DOCDIR%%/qtgui/qtextlength.html
%%QT_DOCDIR%%/qtgui/qtextline-members.html
%%QT_DOCDIR%%/qtgui/qtextline.html
%%QT_DOCDIR%%/qtgui/qtextlist-members.html
%%QT_DOCDIR%%/qtgui/qtextlist-obsolete.html
%%QT_DOCDIR%%/qtgui/qtextlist.html
%%QT_DOCDIR%%/qtgui/qtextlistformat-members.html
%%QT_DOCDIR%%/qtgui/qtextlistformat.html
%%QT_DOCDIR%%/qtgui/qtextobject-members.html
%%QT_DOCDIR%%/qtgui/qtextobject.html
%%QT_DOCDIR%%/qtgui/qtextobjectinterface-members.html
%%QT_DOCDIR%%/qtgui/qtextobjectinterface.html
%%QT_DOCDIR%%/qtgui/qtextoption-members.html
%%QT_DOCDIR%%/qtgui/qtextoption-tab-members.html
%%QT_DOCDIR%%/qtgui/qtextoption-tab.html
%%QT_DOCDIR%%/qtgui/qtextoption.html
%%QT_DOCDIR%%/qtgui/qtexttable-members.html
%%QT_DOCDIR%%/qtgui/qtexttable.html
%%QT_DOCDIR%%/qtgui/qtexttablecell-members.html
%%QT_DOCDIR%%/qtgui/qtexttablecell.html
%%QT_DOCDIR%%/qtgui/qtexttablecellformat-members.html
%%QT_DOCDIR%%/qtgui/qtexttablecellformat.html
%%QT_DOCDIR%%/qtgui/qtexttableformat-members.html
%%QT_DOCDIR%%/qtgui/qtexttableformat.html
%%QT_DOCDIR%%/qtgui/qtgui-analogclock-analogclock-pro.html
%%QT_DOCDIR%%/qtgui/qtgui-analogclock-example.html
%%QT_DOCDIR%%/qtgui/qtgui-analogclock-main-cpp.html
%%QT_DOCDIR%%/qtgui/qtgui-index.html
%%QT_DOCDIR%%/qtgui/qtgui-module.html
%%QT_DOCDIR%%/qtgui/qtgui-openglwindow-example.html
%%QT_DOCDIR%%/qtgui/qtgui-openglwindow-main-cpp.html
%%QT_DOCDIR%%/qtgui/qtgui-openglwindow-openglwindow-cpp.html
%%QT_DOCDIR%%/qtgui/qtgui-openglwindow-openglwindow-h.html
%%QT_DOCDIR%%/qtgui/qtgui-openglwindow-openglwindow-pro.html
%%QT_DOCDIR%%/qtgui/qtgui-rasterwindow-example.html
%%QT_DOCDIR%%/qtgui/qtgui-rasterwindow-main-cpp.html
%%QT_DOCDIR%%/qtgui/qtgui-rasterwindow-rasterwindow-cpp.html
%%QT_DOCDIR%%/qtgui/qtgui-rasterwindow-rasterwindow-h.html
%%QT_DOCDIR%%/qtgui/qtgui-rasterwindow-rasterwindow-pro.html
%%QT_DOCDIR%%/qtgui/qtgui.index
%%QT_DOCDIR%%/qtgui/qtgui.qhp
%%QT_DOCDIR%%/qtgui/qtgui.qhp.sha1
%%QT_DOCDIR%%/qtgui/qtgui.tags
%%QT_DOCDIR%%/qtgui/qtouchdevice-members.html
%%QT_DOCDIR%%/qtgui/qtouchdevice.html
%%QT_DOCDIR%%/qtgui/qtouchevent-members.html
%%QT_DOCDIR%%/qtgui/qtouchevent-obsolete.html
%%QT_DOCDIR%%/qtgui/qtouchevent-touchpoint-members.html
%%QT_DOCDIR%%/qtgui/qtouchevent-touchpoint.html
%%QT_DOCDIR%%/qtgui/qtouchevent.html
%%QT_DOCDIR%%/qtgui/qtransform-members.html
%%QT_DOCDIR%%/qtgui/qtransform-obsolete.html
%%QT_DOCDIR%%/qtgui/qtransform.html
%%QT_DOCDIR%%/qtgui/qvalidator-members.html
%%QT_DOCDIR%%/qtgui/qvalidator.html
%%QT_DOCDIR%%/qtgui/qvector2d-members.html
%%QT_DOCDIR%%/qtgui/qvector2d.html
%%QT_DOCDIR%%/qtgui/qvector3d-members.html
%%QT_DOCDIR%%/qtgui/qvector3d.html
%%QT_DOCDIR%%/qtgui/qvector4d-members.html
%%QT_DOCDIR%%/qtgui/qvector4d.html
%%QT_DOCDIR%%/qtgui/qwhatsthisclickedevent-members.html
%%QT_DOCDIR%%/qtgui/qwhatsthisclickedevent.html
%%QT_DOCDIR%%/qtgui/qwheelevent-members.html
%%QT_DOCDIR%%/qtgui/qwheelevent-obsolete.html
%%QT_DOCDIR%%/qtgui/qwheelevent.html
%%QT_DOCDIR%%/qtgui/qwindow-members.html
%%QT_DOCDIR%%/qtgui/qwindow.html
%%QT_DOCDIR%%/qtgui/qwindowstatechangeevent-members.html
%%QT_DOCDIR%%/qtgui/qwindowstatechangeevent.html
%%QT_DOCDIR%%/qtgui/richtext-advanced-processing.html
%%QT_DOCDIR%%/qtgui/richtext-common-tasks.html
%%QT_DOCDIR%%/qtgui/richtext-cursor.html
%%QT_DOCDIR%%/qtgui/richtext-html-subset.html
%%QT_DOCDIR%%/qtgui/richtext-layouts.html
%%QT_DOCDIR%%/qtgui/richtext-processing.html
%%QT_DOCDIR%%/qtgui/richtext-structure.html
%%QT_DOCDIR%%/qtgui/richtext.html
%%QT_DOCDIR%%/qtgui/style/offline-simple.css
%%QT_DOCDIR%%/qtgui/style/offline.css
%%QT_DOCDIR%%/qthelp.qch
%%QT_DOCDIR%%/qthelp/examples-manifest.xml
%%QT_DOCDIR%%/qthelp/examples-qthelp.html
%%QT_DOCDIR%%/qthelp/helpsystem.html
%%QT_DOCDIR%%/qthelp/images/arrow_bc.png
%%QT_DOCDIR%%/qthelp/images/bgrContent.png
%%QT_DOCDIR%%/qthelp/images/btn_next.png
%%QT_DOCDIR%%/qthelp/images/btn_prev.png
%%QT_DOCDIR%%/qthelp/images/bullet_dn.png
%%QT_DOCDIR%%/qthelp/images/bullet_sq.png
%%QT_DOCDIR%%/qthelp/images/home.png
%%QT_DOCDIR%%/qthelp/images/ico_note.png
%%QT_DOCDIR%%/qthelp/images/ico_note_attention.png
%%QT_DOCDIR%%/qthelp/images/ico_out.png
%%QT_DOCDIR%%/qthelp/images/logo.png
%%QT_DOCDIR%%/qthelp/qhelpcontentitem-members.html
%%QT_DOCDIR%%/qthelp/qhelpcontentitem.html
%%QT_DOCDIR%%/qthelp/qhelpcontentmodel-members.html
%%QT_DOCDIR%%/qthelp/qhelpcontentmodel.html
%%QT_DOCDIR%%/qthelp/qhelpcontentwidget-members.html
%%QT_DOCDIR%%/qthelp/qhelpcontentwidget.html
%%QT_DOCDIR%%/qthelp/qhelpengine-members.html
%%QT_DOCDIR%%/qthelp/qhelpengine.html
%%QT_DOCDIR%%/qthelp/qhelpenginecore-members.html
%%QT_DOCDIR%%/qthelp/qhelpenginecore.html
%%QT_DOCDIR%%/qthelp/qhelpindexmodel-members.html
%%QT_DOCDIR%%/qthelp/qhelpindexmodel.html
%%QT_DOCDIR%%/qthelp/qhelpindexwidget-members.html
%%QT_DOCDIR%%/qthelp/qhelpindexwidget.html
%%QT_DOCDIR%%/qthelp/qhelpsearchengine-members.html
%%QT_DOCDIR%%/qthelp/qhelpsearchengine-obsolete.html
%%QT_DOCDIR%%/qthelp/qhelpsearchengine.html
%%QT_DOCDIR%%/qthelp/qhelpsearchquery-members.html
%%QT_DOCDIR%%/qthelp/qhelpsearchquery.html
%%QT_DOCDIR%%/qthelp/qhelpsearchquerywidget-members.html
%%QT_DOCDIR%%/qthelp/qhelpsearchquerywidget.html
%%QT_DOCDIR%%/qthelp/qhelpsearchresultwidget-members.html
%%QT_DOCDIR%%/qthelp/qhelpsearchresultwidget.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-example.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-helpbrowser-cpp.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-helpbrowser-h.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-main-cpp.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-h.html
%%QT_DOCDIR%%/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
%%QT_DOCDIR%%/qthelp/qthelp-framework.html
%%QT_DOCDIR%%/qthelp/qthelp-index.html
%%QT_DOCDIR%%/qthelp/qthelp-module.html
%%QT_DOCDIR%%/qthelp/qthelp.index
%%QT_DOCDIR%%/qthelp/qthelp.qhp
%%QT_DOCDIR%%/qthelp/qthelp.qhp.sha1
%%QT_DOCDIR%%/qthelp/qthelpproject.html
%%QT_DOCDIR%%/qthelp/style/offline-simple.css
%%QT_DOCDIR%%/qthelp/style/offline.css
%%QT_DOCDIR%%/qtimageformats.qch
%%QT_DOCDIR%%/qtimageformats/images/arrow_bc.png
%%QT_DOCDIR%%/qtimageformats/images/bgrContent.png
%%QT_DOCDIR%%/qtimageformats/images/btn_next.png
%%QT_DOCDIR%%/qtimageformats/images/btn_prev.png
%%QT_DOCDIR%%/qtimageformats/images/bullet_dn.png
%%QT_DOCDIR%%/qtimageformats/images/bullet_sq.png
%%QT_DOCDIR%%/qtimageformats/images/home.png
%%QT_DOCDIR%%/qtimageformats/images/ico_note.png
%%QT_DOCDIR%%/qtimageformats/images/ico_note_attention.png
%%QT_DOCDIR%%/qtimageformats/images/ico_out.png
%%QT_DOCDIR%%/qtimageformats/images/logo.png
%%QT_DOCDIR%%/qtimageformats/qtimageformats-index.html
%%QT_DOCDIR%%/qtimageformats/qtimageformats.index
%%QT_DOCDIR%%/qtimageformats/qtimageformats.qhp
%%QT_DOCDIR%%/qtimageformats/qtimageformats.qhp.sha1
%%QT_DOCDIR%%/qtimageformats/style/offline-simple.css
%%QT_DOCDIR%%/qtimageformats/style/offline.css
%%QT_DOCDIR%%/qtlinguist.qch
%%QT_DOCDIR%%/qtlinguist/examples-linguist.html
%%QT_DOCDIR%%/qtlinguist/examples-manifest.xml
%%QT_DOCDIR%%/qtlinguist/images/arrow_bc.png
%%QT_DOCDIR%%/qtlinguist/images/bgrContent.png
%%QT_DOCDIR%%/qtlinguist/images/btn_next.png
%%QT_DOCDIR%%/qtlinguist/images/btn_prev.png
%%QT_DOCDIR%%/qtlinguist/images/bullet_dn.png
%%QT_DOCDIR%%/qtlinguist/images/bullet_sq.png
%%QT_DOCDIR%%/qtlinguist/images/home.png
%%QT_DOCDIR%%/qtlinguist/images/ico_note.png
%%QT_DOCDIR%%/qtlinguist/images/ico_note_attention.png
%%QT_DOCDIR%%/qtlinguist/images/ico_out.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-arrowpad_en.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-arrowpad_fr.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-arrowpad_nl.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-batchtranslation.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-check-empty.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-check-obsolete.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-check-off.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-check-on.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-check-warning.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-danger.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-doneandnext.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-hellotr_en.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-hellotr_la.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-linguist.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-linguist_2.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-phrasebookdialog.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-translationfilesettings.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-trollprint_10_en.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-trollprint_10_pt_bad.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-trollprint_10_pt_good.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-trollprint_11_en.png
%%QT_DOCDIR%%/qtlinguist/images/linguist-trollprint_11_pt.png
%%QT_DOCDIR%%/qtlinguist/images/logo.png
%%QT_DOCDIR%%/qtlinguist/linguist-id-based-i18n.html
%%QT_DOCDIR%%/qtlinguist/linguist-manager.html
%%QT_DOCDIR%%/qtlinguist/linguist-overview.html
%%QT_DOCDIR%%/qtlinguist/linguist-programmers.html
%%QT_DOCDIR%%/qtlinguist/linguist-translators.html
%%QT_DOCDIR%%/qtlinguist/linguist-ts-file-format.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-arrowpad-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-arrowpad-h.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-arrowpad-pro.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-example.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-main-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-mainwindow-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-arrowpad-mainwindow-h.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-hellotr-example.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-hellotr-hellotr-pro.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-hellotr-main-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-index.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-example.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-main-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-mainwindow-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-mainwindow-h.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-printpanel-cpp.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-printpanel-h.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist-trollprint-trollprint-pro.html
%%QT_DOCDIR%%/qtlinguist/qtlinguist.index
%%QT_DOCDIR%%/qtlinguist/qtlinguist.qhp
%%QT_DOCDIR%%/qtlinguist/qtlinguist.qhp.sha1
%%QT_DOCDIR%%/qtlinguist/style/offline-simple.css
%%QT_DOCDIR%%/qtlinguist/style/offline.css
%%QT_DOCDIR%%/qtlocation.qch
%%QT_DOCDIR%%/qtlocation/examples-manifest.xml
%%QT_DOCDIR%%/qtlocation/images/api-mapcircle.png
%%QT_DOCDIR%%/qtlocation/images/api-mappolygon.png
%%QT_DOCDIR%%/qtlocation/images/api-mappolyline.png
%%QT_DOCDIR%%/qtlocation/images/api-mapquickitem-anchor.png
%%QT_DOCDIR%%/qtlocation/images/api-mapquickitem.png
%%QT_DOCDIR%%/qtlocation/images/api-maprectangle.png
%%QT_DOCDIR%%/qtlocation/images/arrow_bc.png
%%QT_DOCDIR%%/qtlocation/images/bgrContent.png
%%QT_DOCDIR%%/qtlocation/images/btn_next.png
%%QT_DOCDIR%%/qtlocation/images/btn_prev.png
%%QT_DOCDIR%%/qtlocation/images/bullet_dn.png
%%QT_DOCDIR%%/qtlocation/images/bullet_sq.png
%%QT_DOCDIR%%/qtlocation/images/home.png
%%QT_DOCDIR%%/qtlocation/images/ico_note.png
%%QT_DOCDIR%%/qtlocation/images/ico_note_attention.png
%%QT_DOCDIR%%/qtlocation/images/ico_out.png
%%QT_DOCDIR%%/qtlocation/images/logo.png
%%QT_DOCDIR%%/qtlocation/images/mapviewer.png
%%QT_DOCDIR%%/qtlocation/images/minimal_map.png
%%QT_DOCDIR%%/qtlocation/images/places.png
%%QT_DOCDIR%%/qtlocation/images/places_list.png
%%QT_DOCDIR%%/qtlocation/images/places_map.png
%%QT_DOCDIR%%/qtlocation/images/planespotter.png
%%QT_DOCDIR%%/qtlocation/location-cpp-qml.html
%%QT_DOCDIR%%/qtlocation/location-maps-cpp.html
%%QT_DOCDIR%%/qtlocation/location-maps-qml.html
%%QT_DOCDIR%%/qtlocation/location-places-backend.html
%%QT_DOCDIR%%/qtlocation/location-places-cpp.html
%%QT_DOCDIR%%/qtlocation/location-places-qml.html
%%QT_DOCDIR%%/qtlocation/location-plugin-here.html
%%QT_DOCDIR%%/qtlocation/location-plugin-mapbox.html
%%QT_DOCDIR%%/qtlocation/location-plugin-osm.html
%%QT_DOCDIR%%/qtlocation/qgeocodereply-members.html
%%QT_DOCDIR%%/qtlocation/qgeocodereply.html
%%QT_DOCDIR%%/qtlocation/qgeocodingmanager-members.html
%%QT_DOCDIR%%/qtlocation/qgeocodingmanager.html
%%QT_DOCDIR%%/qtlocation/qgeocodingmanagerengine-members.html
%%QT_DOCDIR%%/qtlocation/qgeocodingmanagerengine.html
%%QT_DOCDIR%%/qtlocation/qgeomaneuver-members.html
%%QT_DOCDIR%%/qtlocation/qgeomaneuver.html
%%QT_DOCDIR%%/qtlocation/qgeoroute-members.html
%%QT_DOCDIR%%/qtlocation/qgeoroute.html
%%QT_DOCDIR%%/qtlocation/qgeoroutereply-members.html
%%QT_DOCDIR%%/qtlocation/qgeoroutereply.html
%%QT_DOCDIR%%/qtlocation/qgeorouterequest-members.html
%%QT_DOCDIR%%/qtlocation/qgeorouterequest.html
%%QT_DOCDIR%%/qtlocation/qgeoroutesegment-members.html
%%QT_DOCDIR%%/qtlocation/qgeoroutesegment.html
%%QT_DOCDIR%%/qtlocation/qgeoroutingmanager-members.html
%%QT_DOCDIR%%/qtlocation/qgeoroutingmanager.html
%%QT_DOCDIR%%/qtlocation/qgeoroutingmanagerengine-members.html
%%QT_DOCDIR%%/qtlocation/qgeoroutingmanagerengine.html
%%QT_DOCDIR%%/qtlocation/qgeoserviceprovider-members.html
%%QT_DOCDIR%%/qtlocation/qgeoserviceprovider.html
%%QT_DOCDIR%%/qtlocation/qgeoserviceproviderfactory-members.html
%%QT_DOCDIR%%/qtlocation/qgeoserviceproviderfactory.html
%%QT_DOCDIR%%/qtlocation/qlocation.html
%%QT_DOCDIR%%/qtlocation/qml-location5-maps.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-category-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-category.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-categorymodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-categorymodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-contactdetail-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-contactdetail.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-contactdetails-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-contactdetails.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-editorialmodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-editorialmodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-extendedattributes-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-extendedattributes.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-geocodemodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-geocodemodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-icon-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-icon.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-imagemodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-imagemodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-map-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-map.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapcircle-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapcircle.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapgesturearea-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapgesturearea.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapitemview-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapitemview.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappinchevent-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappinchevent.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappolygon-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappolygon.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappolyline-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mappolyline.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapquickitem-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-mapquickitem.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maprectangle-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maprectangle.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maproute-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maproute.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maptype-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-maptype.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-place-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-place.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placeattribute-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placeattribute.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placesearchmodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placesearchmodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-plugin-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-plugin.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-pluginparameter-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-pluginparameter.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-ratings-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-ratings.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-reviewmodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-reviewmodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-route-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-route.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routemaneuver-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routemaneuver.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routemodel-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routemodel.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routequery-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routequery.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routesegment-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-routesegment.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-supplier-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-supplier.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-user-members.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation-user.html
%%QT_DOCDIR%%/qtlocation/qml-qtlocation5-maps.html
%%QT_DOCDIR%%/qtlocation/qplace-members.html
%%QT_DOCDIR%%/qtlocation/qplace.html
%%QT_DOCDIR%%/qtlocation/qplaceattribute-members.html
%%QT_DOCDIR%%/qtlocation/qplaceattribute.html
%%QT_DOCDIR%%/qtlocation/qplacecategory-members.html
%%QT_DOCDIR%%/qtlocation/qplacecategory.html
%%QT_DOCDIR%%/qtlocation/qplacecontactdetail-members.html
%%QT_DOCDIR%%/qtlocation/qplacecontactdetail.html
%%QT_DOCDIR%%/qtlocation/qplacecontent-members.html
%%QT_DOCDIR%%/qtlocation/qplacecontent.html
%%QT_DOCDIR%%/qtlocation/qplacecontentreply-members.html
%%QT_DOCDIR%%/qtlocation/qplacecontentreply.html
%%QT_DOCDIR%%/qtlocation/qplacecontentrequest-members.html
%%QT_DOCDIR%%/qtlocation/qplacecontentrequest.html
%%QT_DOCDIR%%/qtlocation/qplacedetailsreply-members.html
%%QT_DOCDIR%%/qtlocation/qplacedetailsreply.html
%%QT_DOCDIR%%/qtlocation/qplaceeditorial-members.html
%%QT_DOCDIR%%/qtlocation/qplaceeditorial.html
%%QT_DOCDIR%%/qtlocation/qplaceicon-members.html
%%QT_DOCDIR%%/qtlocation/qplaceicon.html
%%QT_DOCDIR%%/qtlocation/qplaceidreply-members.html
%%QT_DOCDIR%%/qtlocation/qplaceidreply.html
%%QT_DOCDIR%%/qtlocation/qplaceimage-members.html
%%QT_DOCDIR%%/qtlocation/qplaceimage.html
%%QT_DOCDIR%%/qtlocation/qplacemanager-members.html
%%QT_DOCDIR%%/qtlocation/qplacemanager.html
%%QT_DOCDIR%%/qtlocation/qplacemanagerengine-members.html
%%QT_DOCDIR%%/qtlocation/qplacemanagerengine.html
%%QT_DOCDIR%%/qtlocation/qplacematchreply-members.html
%%QT_DOCDIR%%/qtlocation/qplacematchreply.html
%%QT_DOCDIR%%/qtlocation/qplacematchrequest-members.html
%%QT_DOCDIR%%/qtlocation/qplacematchrequest.html
%%QT_DOCDIR%%/qtlocation/qplaceproposedsearchresult-members.html
%%QT_DOCDIR%%/qtlocation/qplaceproposedsearchresult.html
%%QT_DOCDIR%%/qtlocation/qplaceratings-members.html
%%QT_DOCDIR%%/qtlocation/qplaceratings.html
%%QT_DOCDIR%%/qtlocation/qplacereply-members.html
%%QT_DOCDIR%%/qtlocation/qplacereply.html
%%QT_DOCDIR%%/qtlocation/qplaceresult-members.html
%%QT_DOCDIR%%/qtlocation/qplaceresult.html
%%QT_DOCDIR%%/qtlocation/qplacereview-members.html
%%QT_DOCDIR%%/qtlocation/qplacereview.html
%%QT_DOCDIR%%/qtlocation/qplacesearchreply-members.html
%%QT_DOCDIR%%/qtlocation/qplacesearchreply.html
%%QT_DOCDIR%%/qtlocation/qplacesearchrequest-members.html
%%QT_DOCDIR%%/qtlocation/qplacesearchrequest.html
%%QT_DOCDIR%%/qtlocation/qplacesearchresult-members.html
%%QT_DOCDIR%%/qtlocation/qplacesearchresult.html
%%QT_DOCDIR%%/qtlocation/qplacesearchsuggestionreply-members.html
%%QT_DOCDIR%%/qtlocation/qplacesearchsuggestionreply.html
%%QT_DOCDIR%%/qtlocation/qplacesupplier-members.html
%%QT_DOCDIR%%/qtlocation/qplacesupplier.html
%%QT_DOCDIR%%/qtlocation/qplaceuser-members.html
%%QT_DOCDIR%%/qtlocation/qplaceuser.html
%%QT_DOCDIR%%/qtlocation/qtlocation-changes.html
%%QT_DOCDIR%%/qtlocation/qtlocation-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-examples.html
%%QT_DOCDIR%%/qtlocation/qtlocation-geoservices.html
%%QT_DOCDIR%%/qtlocation/qtlocation-index.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-geocode-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-geocodeform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-locale-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-localeform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-message-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-messageform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-reversegeocode-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routeaddress-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routecoordinate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routelist-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routelistdelegate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-forms-routelistheader-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-helper-js.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-circleitem-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-imageitem-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-mapcomponent-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-marker-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-minimap-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-polygonitem-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-polylineitem-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-map-rectangleitem-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-mapviewer-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-mapviewer-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-mapviewer-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-menus-itempopupmenu-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-menus-mainmenu-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-menus-mappopupmenu-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-mapviewer-menus-markerpopupmenu-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-minimal-map-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-minimal-map-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-minimal-map-main-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-minimal-map-minimal-map-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-minimal-map-qml-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-module.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-message-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-messageform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-placedetails-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-placedetailsform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchboundingbox-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchboundingboxform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchboundingcircle-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchboundingcircleform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchcenter-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchcenterform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchoptions-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-forms-searchoptionsform-ui-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-helper-js.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-items-mainmenu-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-items-mapcomponent-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-items-searchbar-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-marker-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-places-list-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-places-list-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-list-places-list-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-map-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-map-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-map-places-map-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-map-places-map-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-map-places-map-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-places-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-places-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-places-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-categorydelegate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-categoryview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-editorialdelegate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-editorialpage-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-editorialview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-imageview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-ratingview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-reviewdelegate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-reviewpage-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-reviewview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-searchresultdelegate-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-searchresultview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-places-views-suggestionview-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-example.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-main-cpp.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-plane-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-planespotter-pro.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-planespotter-qml.html
%%QT_DOCDIR%%/qtlocation/qtlocation-planespotter-qml-qrc.html
%%QT_DOCDIR%%/qtlocation/qtlocation-qmlmodule.html
%%QT_DOCDIR%%/qtlocation/qtlocation.index
%%QT_DOCDIR%%/qtlocation/qtlocation.qhp
%%QT_DOCDIR%%/qtlocation/qtlocation.qhp.sha1
%%QT_DOCDIR%%/qtlocation/qtlocation.tags
%%QT_DOCDIR%%/qtlocation/style/offline-simple.css
%%QT_DOCDIR%%/qtlocation/style/offline.css
%%QT_DOCDIR%%/qtmacextras.qch
%%QT_DOCDIR%%/qtmacextras/examples-manifest.xml
%%QT_DOCDIR%%/qtmacextras/examples-qtmacextras.html
%%QT_DOCDIR%%/qtmacextras/images/arrow_bc.png
%%QT_DOCDIR%%/qtmacextras/images/bgrContent.png
%%QT_DOCDIR%%/qtmacextras/images/btn_next.png
%%QT_DOCDIR%%/qtmacextras/images/btn_prev.png
%%QT_DOCDIR%%/qtmacextras/images/bullet_dn.png
%%QT_DOCDIR%%/qtmacextras/images/bullet_sq.png
%%QT_DOCDIR%%/qtmacextras/images/home.png
%%QT_DOCDIR%%/qtmacextras/images/ico_note.png
%%QT_DOCDIR%%/qtmacextras/images/ico_note_attention.png
%%QT_DOCDIR%%/qtmacextras/images/ico_out.png
%%QT_DOCDIR%%/qtmacextras/images/logo.png
%%QT_DOCDIR%%/qtmacextras/qmacpasteboardmime-members.html
%%QT_DOCDIR%%/qtmacextras/qmacpasteboardmime.html
%%QT_DOCDIR%%/qtmacextras/qmactoolbar-members.html
%%QT_DOCDIR%%/qtmacextras/qmactoolbar.html
%%QT_DOCDIR%%/qtmacextras/qmactoolbaritem-members.html
%%QT_DOCDIR%%/qtmacextras/qmactoolbaritem.html
%%QT_DOCDIR%%/qtmacextras/qtmac-obsolete.html
%%QT_DOCDIR%%/qtmacextras/qtmac.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-embeddedqwindow-example.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-embeddedqwindow-window-cpp.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-embeddedqwindow-window-h.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-index.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macfunctions-example.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macfunctions-macfunctions-pro.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macfunctions-macfunctions-qrc.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macfunctions-main-cpp.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macpasteboardmime-example.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-macpasteboardmime-main-cpp.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras-module.html
%%QT_DOCDIR%%/qtmacextras/qtmacextras.index
%%QT_DOCDIR%%/qtmacextras/qtmacextras.qhp
%%QT_DOCDIR%%/qtmacextras/qtmacextras.qhp.sha1
%%QT_DOCDIR%%/qtmacextras/style/offline-simple.css
%%QT_DOCDIR%%/qtmacextras/style/offline.css
%%QT_DOCDIR%%/qtmultimedia.qch
%%QT_DOCDIR%%/qtmultimedia/audiooverview.html
%%QT_DOCDIR%%/qtmultimedia/blackberry.html
%%QT_DOCDIR%%/qtmultimedia/cameraoverview.html
%%QT_DOCDIR%%/qtmultimedia/changes.html
%%QT_DOCDIR%%/qtmultimedia/examples-manifest.xml
%%QT_DOCDIR%%/qtmultimedia/images/arrow_bc.png
%%QT_DOCDIR%%/qtmultimedia/images/audiodevices.png
%%QT_DOCDIR%%/qtmultimedia/images/audioinput-example.png
%%QT_DOCDIR%%/qtmultimedia/images/audiooutput-example.png
%%QT_DOCDIR%%/qtmultimedia/images/audiorecorder.png
%%QT_DOCDIR%%/qtmultimedia/images/bgrContent.png
%%QT_DOCDIR%%/qtmultimedia/images/btn_next.png
%%QT_DOCDIR%%/qtmultimedia/images/btn_prev.png
%%QT_DOCDIR%%/qtmultimedia/images/bullet_dn.png
%%QT_DOCDIR%%/qtmultimedia/images/bullet_sq.png
%%QT_DOCDIR%%/qtmultimedia/images/camera-example.png
%%QT_DOCDIR%%/qtmultimedia/images/declarative-radio-example.png
%%QT_DOCDIR%%/qtmultimedia/images/home.png
%%QT_DOCDIR%%/qtmultimedia/images/ico_note.png
%%QT_DOCDIR%%/qtmultimedia/images/ico_note_attention.png
%%QT_DOCDIR%%/qtmultimedia/images/ico_out.png
%%QT_DOCDIR%%/qtmultimedia/images/logo.png
%%QT_DOCDIR%%/qtmultimedia/images/mediaplayerex.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qml-camera.png
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideo-menu.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideo-overlay.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideofx-camera-glow.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideofx-effects-menu.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
%%QT_DOCDIR%%/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
%%QT_DOCDIR%%/qtmultimedia/images/radio-example.png
%%QT_DOCDIR%%/qtmultimedia/images/spectrum-demo.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_auto_mode.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_camera_setting.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_auto.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_fill.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_off.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_redeye.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_cloudy.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_flourescent.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_incandescent.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_sunny.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/toolbutton.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/folder.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/leaves.jpg
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/up.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Dropdown_arrows.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_bar.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_handle.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_Top.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_bottom.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_BackArrow.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Folder.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Menu.png
%%QT_DOCDIR%%/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/qt-logo.png
%%QT_DOCDIR%%/qtmultimedia/images/video-qml-paint-rate.png
%%QT_DOCDIR%%/qtmultimedia/images/video-videographicsitem.png
%%QT_DOCDIR%%/qtmultimedia/images/video-videowidget.png
%%QT_DOCDIR%%/qtmultimedia/multimedia-examples.html
%%QT_DOCDIR%%/qtmultimedia/multimediabackend.html
%%QT_DOCDIR%%/qtmultimedia/multimediaoverview.html
%%QT_DOCDIR%%/qtmultimedia/qabstractplanarvideobuffer-members.html
%%QT_DOCDIR%%/qtmultimedia/qabstractplanarvideobuffer.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideobuffer-members.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideobuffer.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideofilter-members.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideofilter.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideosurface-members.html
%%QT_DOCDIR%%/qtmultimedia/qabstractvideosurface.html
%%QT_DOCDIR%%/qtmultimedia/qaudio.html
%%QT_DOCDIR%%/qtmultimedia/qaudiobuffer-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiobuffer-stereoframe-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiobuffer-stereoframe.html
%%QT_DOCDIR%%/qtmultimedia/qaudiobuffer.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodecoder-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodecoder.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodecodercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodecodercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodeviceinfo-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiodeviceinfo.html
%%QT_DOCDIR%%/qtmultimedia/qaudioencodersettings-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioencodersettings.html
%%QT_DOCDIR%%/qtmultimedia/qaudioencodersettingscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioencodersettingscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qaudioformat-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioformat.html
%%QT_DOCDIR%%/qtmultimedia/qaudioinput-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioinput.html
%%QT_DOCDIR%%/qtmultimedia/qaudioinputselectorcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioinputselectorcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qaudiooutput-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiooutput.html
%%QT_DOCDIR%%/qtmultimedia/qaudiooutputselectorcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiooutputselectorcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qaudioprobe-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudioprobe.html
%%QT_DOCDIR%%/qtmultimedia/qaudiorecorder-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiorecorder.html
%%QT_DOCDIR%%/qtmultimedia/qaudiorolecontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qaudiorolecontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcamera-frameraterange-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamera-frameraterange.html
%%QT_DOCDIR%%/qtmultimedia/qcamera-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamera-obsolete.html
%%QT_DOCDIR%%/qtmultimedia/qcamera.html
%%QT_DOCDIR%%/qtmultimedia/qcameracapturebufferformatcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameracapturebufferformatcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameracapturedestinationcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameracapturedestinationcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameracontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameracontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameraexposure-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraexposure.html
%%QT_DOCDIR%%/qtmultimedia/qcameraexposurecontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraexposurecontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafeedbackcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafeedbackcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameraflashcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraflashcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocus-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocus.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocuscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocuscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocuszone-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerafocuszone.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimagecapture-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimagecapture.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimagecapturecontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimagecapturecontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimageprocessing-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimageprocessing.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimageprocessingcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraimageprocessingcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcamerainfo-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerainfo.html
%%QT_DOCDIR%%/qtmultimedia/qcamerainfocontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerainfocontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameralockscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameralockscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfinder-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfinder.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettings-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettings.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettingscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettingscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
%%QT_DOCDIR%%/qtmultimedia/qcameraviewfindersettingscontrol2.html
%%QT_DOCDIR%%/qtmultimedia/qcamerazoomcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qcamerazoomcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qgraphicsvideoitem-members.html
%%QT_DOCDIR%%/qtmultimedia/qgraphicsvideoitem.html
%%QT_DOCDIR%%/qtmultimedia/qimageencodercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qimageencodercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qimageencodersettings-members.html
%%QT_DOCDIR%%/qtmultimedia/qimageencodersettings.html
%%QT_DOCDIR%%/qtmultimedia/qmediaaudioprobecontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaaudioprobecontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediaavailabilitycontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaavailabilitycontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediabindableinterface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediabindableinterface.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontainercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontainercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontent-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontent.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediacontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediagaplessplaybackcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediagaplessplaybackcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediametadata.html
%%QT_DOCDIR%%/qtmultimedia/qmedianetworkaccesscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmedianetworkaccesscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediaobject-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaobject.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplayer-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplayer-obsolete.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplayer.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplayercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplayercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplaylist-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaplaylist.html
%%QT_DOCDIR%%/qtmultimedia/qmediarecorder-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediarecorder.html
%%QT_DOCDIR%%/qtmultimedia/qmediarecordercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediarecordercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediaresource-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaresource.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservice-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservice.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicecamerainfointerface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicecamerainfointerface.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicedefaultdeviceinterface.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicefeaturesinterface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicefeaturesinterface.html
%%QT_DOCDIR%%/qtmultimedia/qmediaserviceproviderplugin-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaserviceproviderplugin.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicesupporteddevicesinterface.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediaservicesupportedformatsinterface.html
%%QT_DOCDIR%%/qtmultimedia/qmediastreamscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediastreamscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmediatimeinterval-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediatimeinterval.html
%%QT_DOCDIR%%/qtmultimedia/qmediatimerange-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediatimerange.html
%%QT_DOCDIR%%/qtmultimedia/qmediavideoprobecontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmediavideoprobecontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmetadatareadercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmetadatareadercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qmetadatawritercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qmetadatawritercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qml-multimedia.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiocategory.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audioengine-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audioengine.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiolistener.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiosample-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-audiosample.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-playvariation-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-playvariation.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-sound-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-sound.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtaudioengine-soundinstance.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-audio-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-audio.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camera-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camera.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameracapture.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraexposure.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraflash.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camerafocus.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-camerarecorder.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-mediaplayer.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-playlist-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-playlist.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-playlistitem.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-radio-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-radio.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-radiodata-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-radiodata.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-soundeffect.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-torch-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-torch.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-video-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-video.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-videooutput-members.html
%%QT_DOCDIR%%/qtmultimedia/qml-qtmultimedia-videooutput.html
%%QT_DOCDIR%%/qtmultimedia/qmultimedia.html
%%QT_DOCDIR%%/qtmultimedia/qradiodata-members.html
%%QT_DOCDIR%%/qtmultimedia/qradiodata.html
%%QT_DOCDIR%%/qtmultimedia/qradiodatacontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qradiodatacontrol.html
%%QT_DOCDIR%%/qtmultimedia/qradiotuner-members.html
%%QT_DOCDIR%%/qtmultimedia/qradiotuner.html
%%QT_DOCDIR%%/qtmultimedia/qradiotunercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qradiotunercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qsound-members.html
%%QT_DOCDIR%%/qtmultimedia/qsound.html
%%QT_DOCDIR%%/qtmultimedia/qsoundeffect-members.html
%%QT_DOCDIR%%/qtmultimedia/qsoundeffect.html
%%QT_DOCDIR%%/qtmultimedia/qtaudioengine-qmlmodule.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-index.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-module.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-modules.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiodevices-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioengine-audioengine-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audioinput-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiooutput-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-qaudiolevel-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-audiorecorder-qaudiolevel-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-popup-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-radio-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-declarative-radio-view-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-app-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-spectrum-spectrum-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-trace-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-ui.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-ui.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-player-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-player-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-player-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-main-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-qmlmodule.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia-windows.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia.index
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia.qhp
%%QT_DOCDIR%%/qtmultimedia/qtmultimedia.qhp.sha1
%%QT_DOCDIR%%/qtmultimedia/qtmultimediawidgets-index.html
%%QT_DOCDIR%%/qtmultimedia/qtmultimediawidgets-module.html
%%QT_DOCDIR%%/qtmultimedia/qvideodeviceselectorcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideodeviceselectorcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qvideoencodersettings-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideoencodersettings.html
%%QT_DOCDIR%%/qtmultimedia/qvideoencodersettingscontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideoencodersettingscontrol.html
%%QT_DOCDIR%%/qtmultimedia/qvideofilterrunnable-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideofilterrunnable.html
%%QT_DOCDIR%%/qtmultimedia/qvideoframe-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideoframe.html
%%QT_DOCDIR%%/qtmultimedia/qvideoprobe-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideoprobe.html
%%QT_DOCDIR%%/qtmultimedia/qvideorenderercontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideorenderercontrol.html
%%QT_DOCDIR%%/qtmultimedia/qvideosurfaceformat-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideosurfaceformat.html
%%QT_DOCDIR%%/qtmultimedia/qvideowidget-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideowidget.html
%%QT_DOCDIR%%/qtmultimedia/qvideowidgetcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideowidgetcontrol.html
%%QT_DOCDIR%%/qtmultimedia/qvideowindowcontrol-members.html
%%QT_DOCDIR%%/qtmultimedia/qvideowindowcontrol.html
%%QT_DOCDIR%%/qtmultimedia/radiooverview.html
%%QT_DOCDIR%%/qtmultimedia/style/offline-simple.css
%%QT_DOCDIR%%/qtmultimedia/style/offline.css
%%QT_DOCDIR%%/qtmultimedia/videooverview.html
%%QT_DOCDIR%%/qtnetwork.qch
%%QT_DOCDIR%%/qtnetwork/bearer-management.html
%%QT_DOCDIR%%/qtnetwork/examples-manifest.xml
%%QT_DOCDIR%%/qtnetwork/examples-network.html
%%QT_DOCDIR%%/qtnetwork/images/arrow_bc.png
%%QT_DOCDIR%%/qtnetwork/images/bgrContent.png
%%QT_DOCDIR%%/qtnetwork/images/blockingfortuneclient-example.png
%%QT_DOCDIR%%/qtnetwork/images/broadcastreceiver-example.png
%%QT_DOCDIR%%/qtnetwork/images/broadcastsender-example.png
%%QT_DOCDIR%%/qtnetwork/images/btn_next.png
%%QT_DOCDIR%%/qtnetwork/images/btn_prev.png
%%QT_DOCDIR%%/qtnetwork/images/bullet_dn.png
%%QT_DOCDIR%%/qtnetwork/images/bullet_sq.png
%%QT_DOCDIR%%/qtnetwork/images/fortuneclient-example.png
%%QT_DOCDIR%%/qtnetwork/images/fortuneserver-example.png
%%QT_DOCDIR%%/qtnetwork/images/googlesuggest-example.png
%%QT_DOCDIR%%/qtnetwork/images/home.png
%%QT_DOCDIR%%/qtnetwork/images/http-example.png
%%QT_DOCDIR%%/qtnetwork/images/ico_note.png
%%QT_DOCDIR%%/qtnetwork/images/ico_note_attention.png
%%QT_DOCDIR%%/qtnetwork/images/ico_out.png
%%QT_DOCDIR%%/qtnetwork/images/logo.png
%%QT_DOCDIR%%/qtnetwork/images/loopback-example.png
%%QT_DOCDIR%%/qtnetwork/images/multicastreceiver-example.png
%%QT_DOCDIR%%/qtnetwork/images/multicastsender-example.png
%%QT_DOCDIR%%/qtnetwork/images/network-chat-example.png
%%QT_DOCDIR%%/qtnetwork/images/network-examples.png
%%QT_DOCDIR%%/qtnetwork/images/roaming-states.png
%%QT_DOCDIR%%/qtnetwork/images/securesocketclient.png
%%QT_DOCDIR%%/qtnetwork/images/securesocketclient2.png
%%QT_DOCDIR%%/qtnetwork/images/tcpstream.png
%%QT_DOCDIR%%/qtnetwork/images/threadedfortuneserver-example.png
%%QT_DOCDIR%%/qtnetwork/images/torrent-example.png
%%QT_DOCDIR%%/qtnetwork/images/udppackets.png
%%QT_DOCDIR%%/qtnetwork/network.html
%%QT_DOCDIR%%/qtnetwork/qabstractnetworkcache-members.html
%%QT_DOCDIR%%/qtnetwork/qabstractnetworkcache.html
%%QT_DOCDIR%%/qtnetwork/qabstractsocket-members.html
%%QT_DOCDIR%%/qtnetwork/qabstractsocket.html
%%QT_DOCDIR%%/qtnetwork/qauthenticator-members.html
%%QT_DOCDIR%%/qtnetwork/qauthenticator.html
%%QT_DOCDIR%%/qtnetwork/qdnsdomainnamerecord-members.html
%%QT_DOCDIR%%/qtnetwork/qdnsdomainnamerecord.html
%%QT_DOCDIR%%/qtnetwork/qdnshostaddressrecord-members.html
%%QT_DOCDIR%%/qtnetwork/qdnshostaddressrecord.html
%%QT_DOCDIR%%/qtnetwork/qdnslookup-members.html
%%QT_DOCDIR%%/qtnetwork/qdnslookup.html
%%QT_DOCDIR%%/qtnetwork/qdnsmailexchangerecord-members.html
%%QT_DOCDIR%%/qtnetwork/qdnsmailexchangerecord.html
%%QT_DOCDIR%%/qtnetwork/qdnsservicerecord-members.html
%%QT_DOCDIR%%/qtnetwork/qdnsservicerecord.html
%%QT_DOCDIR%%/qtnetwork/qdnstextrecord-members.html
%%QT_DOCDIR%%/qtnetwork/qdnstextrecord.html
%%QT_DOCDIR%%/qtnetwork/qhostaddress-members.html
%%QT_DOCDIR%%/qtnetwork/qhostaddress.html
%%QT_DOCDIR%%/qtnetwork/qhostinfo-members.html
%%QT_DOCDIR%%/qtnetwork/qhostinfo.html
%%QT_DOCDIR%%/qtnetwork/qhttpmultipart-members.html
%%QT_DOCDIR%%/qtnetwork/qhttpmultipart.html
%%QT_DOCDIR%%/qtnetwork/qhttppart-members.html
%%QT_DOCDIR%%/qtnetwork/qhttppart.html
%%QT_DOCDIR%%/qtnetwork/qlocalserver-members.html
%%QT_DOCDIR%%/qtnetwork/qlocalserver.html
%%QT_DOCDIR%%/qtnetwork/qlocalsocket-members.html
%%QT_DOCDIR%%/qtnetwork/qlocalsocket.html
%%QT_DOCDIR%%/qtnetwork/qnetworkaccessmanager-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkaccessmanager.html
%%QT_DOCDIR%%/qtnetwork/qnetworkaddressentry-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkaddressentry.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcachemetadata-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcachemetadata.html
%%QT_DOCDIR%%/qtnetwork/qnetworkconfiguration-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkconfiguration.html
%%QT_DOCDIR%%/qtnetwork/qnetworkconfigurationmanager-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkconfigurationmanager.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcookie-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcookie.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcookiejar-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkcookiejar.html
%%QT_DOCDIR%%/qtnetwork/qnetworkdiskcache-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkdiskcache.html
%%QT_DOCDIR%%/qtnetwork/qnetworkinterface-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkinterface.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxy-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxy.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxyfactory-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxyfactory.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxyquery-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkproxyquery.html
%%QT_DOCDIR%%/qtnetwork/qnetworkreply-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkreply.html
%%QT_DOCDIR%%/qtnetwork/qnetworkrequest-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworkrequest.html
%%QT_DOCDIR%%/qtnetwork/qnetworksession-members.html
%%QT_DOCDIR%%/qtnetwork/qnetworksession.html
%%QT_DOCDIR%%/qtnetwork/qssl-obsolete.html
%%QT_DOCDIR%%/qtnetwork/qssl.html
%%QT_DOCDIR%%/qtnetwork/qsslcertificate-members.html
%%QT_DOCDIR%%/qtnetwork/qsslcertificate-obsolete.html
%%QT_DOCDIR%%/qtnetwork/qsslcertificate.html
%%QT_DOCDIR%%/qtnetwork/qsslcertificateextension-members.html
%%QT_DOCDIR%%/qtnetwork/qsslcertificateextension.html
%%QT_DOCDIR%%/qtnetwork/qsslcipher-members.html
%%QT_DOCDIR%%/qtnetwork/qsslcipher.html
%%QT_DOCDIR%%/qtnetwork/qsslconfiguration-members.html
%%QT_DOCDIR%%/qtnetwork/qsslconfiguration.html
%%QT_DOCDIR%%/qtnetwork/qsslellipticcurve-members.html
%%QT_DOCDIR%%/qtnetwork/qsslellipticcurve.html
%%QT_DOCDIR%%/qtnetwork/qsslerror-members.html
%%QT_DOCDIR%%/qtnetwork/qsslerror.html
%%QT_DOCDIR%%/qtnetwork/qsslkey-members.html
%%QT_DOCDIR%%/qtnetwork/qsslkey.html
%%QT_DOCDIR%%/qtnetwork/qsslpresharedkeyauthenticator-members.html
%%QT_DOCDIR%%/qtnetwork/qsslpresharedkeyauthenticator.html
%%QT_DOCDIR%%/qtnetwork/qsslsocket-members.html
%%QT_DOCDIR%%/qtnetwork/qsslsocket-obsolete.html
%%QT_DOCDIR%%/qtnetwork/qsslsocket.html
%%QT_DOCDIR%%/qtnetwork/qtcpserver-members.html
%%QT_DOCDIR%%/qtnetwork/qtcpserver.html
%%QT_DOCDIR%%/qtnetwork/qtcpsocket-members.html
%%QT_DOCDIR%%/qtnetwork/qtcpsocket.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-blockingfortuneclient-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastreceiver-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastreceiver-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastreceiver-receiver-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastreceiver-receiver-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastsender-broadcastsender-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastsender-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastsender-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastsender-sender-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-broadcastsender-sender-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-download-download-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-download-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-download-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-downloadmanager-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-downloadmanager-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-downloadmanager-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-textprogressbar-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-downloadmanager-textprogressbar-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneclient-client-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneclient-client-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneclient-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneclient-fortuneclient-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneclient-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneserver-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneserver-fortuneserver-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneserver-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneserver-server-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-fortuneserver-server-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-googlesuggest-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-googlesuggest-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-googlesuggest-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-searchbox-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-googlesuggest-searchbox-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-authenticationdialog-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-http-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-httpwindow-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-httpwindow-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-http-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-index.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-loopback-dialog-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-loopback-dialog-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-loopback-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-loopback-loopback-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-loopback-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-module.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastreceiver-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastreceiver-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastreceiver-multicastreceiver-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastreceiver-receiver-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastreceiver-receiver-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastsender-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastsender-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastsender-multicastsender-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastsender-sender-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-multicastsender-sender-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-chatdialog-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-chatdialog-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-chatdialog-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-client-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-client-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-connection-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-connection-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-network-chat-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-peermanager-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-peermanager-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-server-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-network-chat-server-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-programming.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-certificateinfo-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-certificateinfo-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-certificateinfo-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-securesocketclient-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-securesocketclient-qrc.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-sslclient-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-sslclient-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-sslclient-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-securesocketclient-sslerrors-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-dialog-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-dialog-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-addtorrentdialog-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-addtorrentdialog-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-bencodeparser-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-bencodeparser-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-connectionmanager-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-connectionmanager-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-example.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-filemanager-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-filemanager-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-forms-addtorrentform-ui.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-icons-qrc.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-main-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-mainwindow-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-mainwindow-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-metainfo-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-metainfo-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-peerwireclient-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-peerwireclient-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-ratecontroller-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-ratecontroller-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-torrent-pro.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-torrentclient-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-torrentclient-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-torrentserver-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-torrentserver-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-trackerclient-cpp.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork-torrent-trackerclient-h.html
%%QT_DOCDIR%%/qtnetwork/qtnetwork.index
%%QT_DOCDIR%%/qtnetwork/qtnetwork.qhp
%%QT_DOCDIR%%/qtnetwork/qtnetwork.qhp.sha1
%%QT_DOCDIR%%/qtnetwork/qtnetwork.tags
%%QT_DOCDIR%%/qtnetwork/qudpsocket-members.html
%%QT_DOCDIR%%/qtnetwork/qudpsocket.html
%%QT_DOCDIR%%/qtnetwork/ssl.html
%%QT_DOCDIR%%/qtnetwork/style/offline-simple.css
%%QT_DOCDIR%%/qtnetwork/style/offline.css
%%QT_DOCDIR%%/qtnfc.qch
%%QT_DOCDIR%%/qtnfc/examples-manifest.xml
%%QT_DOCDIR%%/qtnfc/images/annotatedurl.png
%%QT_DOCDIR%%/qtnfc/images/arrow_bc.png
%%QT_DOCDIR%%/qtnfc/images/bgrContent.png
%%QT_DOCDIR%%/qtnfc/images/btn_next.png
%%QT_DOCDIR%%/qtnfc/images/btn_prev.png
%%QT_DOCDIR%%/qtnfc/images/bullet_dn.png
%%QT_DOCDIR%%/qtnfc/images/bullet_sq.png
%%QT_DOCDIR%%/qtnfc/images/corkboard.png
%%QT_DOCDIR%%/qtnfc/images/home.png
%%QT_DOCDIR%%/qtnfc/images/ico_note.png
%%QT_DOCDIR%%/qtnfc/images/ico_note_attention.png
%%QT_DOCDIR%%/qtnfc/images/ico_out.png
%%QT_DOCDIR%%/qtnfc/images/logo.png
%%QT_DOCDIR%%/qtnfc/images/ndefeditor.png
%%QT_DOCDIR%%/qtnfc/images/qml-poster-example.png
%%QT_DOCDIR%%/qtnfc/nfc-android.html
%%QT_DOCDIR%%/qtnfc/nfc-examples.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndeffilter-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndeffilter.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefmimerecord-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefmimerecord.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefrecord-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefrecord.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndeftextrecord-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndeftextrecord.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefurirecord-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-ndefurirecord.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-nearfield-members.html
%%QT_DOCDIR%%/qtnfc/qml-qtnfc-nearfield.html
%%QT_DOCDIR%%/qtnfc/qndeffilter-members.html
%%QT_DOCDIR%%/qtnfc/qndeffilter-record-members.html
%%QT_DOCDIR%%/qtnfc/qndeffilter-record.html
%%QT_DOCDIR%%/qtnfc/qndeffilter.html
%%QT_DOCDIR%%/qtnfc/qndefmessage-members.html
%%QT_DOCDIR%%/qtnfc/qndefmessage.html
%%QT_DOCDIR%%/qtnfc/qndefnfcsmartposterrecord-members.html
%%QT_DOCDIR%%/qtnfc/qndefnfcsmartposterrecord.html
%%QT_DOCDIR%%/qtnfc/qndefnfctextrecord-members.html
%%QT_DOCDIR%%/qtnfc/qndefnfctextrecord.html
%%QT_DOCDIR%%/qtnfc/qndefnfcurirecord-members.html
%%QT_DOCDIR%%/qtnfc/qndefnfcurirecord.html
%%QT_DOCDIR%%/qtnfc/qndefrecord-members.html
%%QT_DOCDIR%%/qtnfc/qndefrecord.html
%%QT_DOCDIR%%/qtnfc/qnearfieldmanager-members.html
%%QT_DOCDIR%%/qtnfc/qnearfieldmanager.html
%%QT_DOCDIR%%/qtnfc/qnearfieldsharemanager-members.html
%%QT_DOCDIR%%/qtnfc/qnearfieldsharemanager.html
%%QT_DOCDIR%%/qtnfc/qnearfieldsharetarget-members.html
%%QT_DOCDIR%%/qtnfc/qnearfieldsharetarget.html
%%QT_DOCDIR%%/qtnfc/qnearfieldtarget-members.html
%%QT_DOCDIR%%/qtnfc/qnearfieldtarget-requestid-members.html
%%QT_DOCDIR%%/qtnfc/qnearfieldtarget-requestid.html
%%QT_DOCDIR%%/qtnfc/qnearfieldtarget-requestidprivate.html
%%QT_DOCDIR%%/qtnfc/qnearfieldtarget.html
%%QT_DOCDIR%%/qtnfc/qqmlndefrecord-members.html
%%QT_DOCDIR%%/qtnfc/qqmlndefrecord.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-annotatedurl-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-annotatedurl-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-annotatedurl-pro.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-example.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-main-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-mainwindow-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-mainwindow-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-annotatedurl-mainwindow-ui.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-corkboard-pro.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-corkboard-qrc.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-corkboards-qml.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-example.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-main-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-corkboard-mode-qml.html
%%QT_DOCDIR%%/qtnfc/qtnfc-index.html
%%QT_DOCDIR%%/qtnfc/qtnfc-module.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-example.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-main-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mainwindow-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mainwindow-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mainwindow-ui.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-ndefeditor-pro.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-textrecordeditor-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-textrecordeditor-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-textrecordeditor-ui.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-urirecordeditor-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-urirecordeditor-h.html
%%QT_DOCDIR%%/qtnfc/qtnfc-ndefeditor-urirecordeditor-ui.html
%%QT_DOCDIR%%/qtnfc/qtnfc-overview.html
%%QT_DOCDIR%%/qtnfc/qtnfc-poster-example.html
%%QT_DOCDIR%%/qtnfc/qtnfc-poster-poster-pro.html
%%QT_DOCDIR%%/qtnfc/qtnfc-poster-poster-qml.html
%%QT_DOCDIR%%/qtnfc/qtnfc-poster-poster-qrc.html
%%QT_DOCDIR%%/qtnfc/qtnfc-poster-qmlposter-cpp.html
%%QT_DOCDIR%%/qtnfc/qtnfc-qmlmodule.html
%%QT_DOCDIR%%/qtnfc/qtnfc.index
%%QT_DOCDIR%%/qtnfc/qtnfc.qhp
%%QT_DOCDIR%%/qtnfc/qtnfc.qhp.sha1
%%QT_DOCDIR%%/qtnfc/qtnfc.tags
%%QT_DOCDIR%%/qtnfc/style/offline-simple.css
%%QT_DOCDIR%%/qtnfc/style/offline.css
%%QT_DOCDIR%%/qtopengl.qch
%%QT_DOCDIR%%/qtopengl/examples-manifest.xml
%%QT_DOCDIR%%/qtopengl/examples-widgets-opengl.html
%%QT_DOCDIR%%/qtopengl/images/2dpainting-example.png
%%QT_DOCDIR%%/qtopengl/images/arrow_bc.png
%%QT_DOCDIR%%/qtopengl/images/bgrContent.png
%%QT_DOCDIR%%/qtopengl/images/btn_next.png
%%QT_DOCDIR%%/qtopengl/images/btn_prev.png
%%QT_DOCDIR%%/qtopengl/images/bullet_dn.png
%%QT_DOCDIR%%/qtopengl/images/bullet_sq.png
%%QT_DOCDIR%%/qtopengl/images/cube.png
%%QT_DOCDIR%%/qtopengl/images/cube_faces.png
%%QT_DOCDIR%%/qtopengl/images/hellogl2-example.png
%%QT_DOCDIR%%/qtopengl/images/home.png
%%QT_DOCDIR%%/qtopengl/images/ico_note.png
%%QT_DOCDIR%%/qtopengl/images/ico_note_attention.png
%%QT_DOCDIR%%/qtopengl/images/ico_out.png
%%QT_DOCDIR%%/qtopengl/images/logo.png
%%QT_DOCDIR%%/qtopengl/images/opengl-examples.png
%%QT_DOCDIR%%/qtopengl/images/textures-example.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side1.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side2.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side3.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side4.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side5.png
%%QT_DOCDIR%%/qtopengl/images/used-in-examples/textures/images/side6.png
%%QT_DOCDIR%%/qtopengl/qgl.html
%%QT_DOCDIR%%/qtopengl/qglbuffer-members.html
%%QT_DOCDIR%%/qtopengl/qglbuffer.html
%%QT_DOCDIR%%/qtopengl/qglcolormap-members.html
%%QT_DOCDIR%%/qtopengl/qglcolormap.html
%%QT_DOCDIR%%/qtopengl/qglcontext-members.html
%%QT_DOCDIR%%/qtopengl/qglcontext-obsolete.html
%%QT_DOCDIR%%/qtopengl/qglcontext.html
%%QT_DOCDIR%%/qtopengl/qglformat-members.html
%%QT_DOCDIR%%/qtopengl/qglformat.html
%%QT_DOCDIR%%/qtopengl/qglframebufferobject-members.html
%%QT_DOCDIR%%/qtopengl/qglframebufferobject.html
%%QT_DOCDIR%%/qtopengl/qglframebufferobjectformat-members.html
%%QT_DOCDIR%%/qtopengl/qglframebufferobjectformat.html
%%QT_DOCDIR%%/qtopengl/qglfunctions-members.html
%%QT_DOCDIR%%/qtopengl/qglfunctions.html
%%QT_DOCDIR%%/qtopengl/qglpixelbuffer-members.html
%%QT_DOCDIR%%/qtopengl/qglpixelbuffer.html
%%QT_DOCDIR%%/qtopengl/qglshader-members.html
%%QT_DOCDIR%%/qtopengl/qglshader.html
%%QT_DOCDIR%%/qtopengl/qglshaderprogram-members.html
%%QT_DOCDIR%%/qtopengl/qglshaderprogram.html
%%QT_DOCDIR%%/qtopengl/qglwidget-members.html
%%QT_DOCDIR%%/qtopengl/qglwidget-obsolete.html
%%QT_DOCDIR%%/qtopengl/qglwidget.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-2dpainting-pro.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-example.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-glwidget-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-glwidget-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-helper-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-helper-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-main-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-widget-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-widget-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-window-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-2dpainting-window-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-cube-pro.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-example.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-fshader-glsl.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-geometryengine-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-geometryengine-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-main-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-mainwidget-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-mainwidget-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-shaders-qrc.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-textures-qrc.html
%%QT_DOCDIR%%/qtopengl/qtopengl-cube-vshader-glsl.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-example.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-glwidget-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-glwidget-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-hellogl2-pro.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-logo-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-logo-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-main-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-mainwindow-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-mainwindow-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-window-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-hellogl2-window-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-index.html
%%QT_DOCDIR%%/qtopengl/qtopengl-module.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-example.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-glwidget-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-glwidget-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-main-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-textures-pro.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-textures-qrc.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-window-cpp.html
%%QT_DOCDIR%%/qtopengl/qtopengl-textures-window-h.html
%%QT_DOCDIR%%/qtopengl/qtopengl.index
%%QT_DOCDIR%%/qtopengl/qtopengl.qhp
%%QT_DOCDIR%%/qtopengl/qtopengl.qhp.sha1
%%QT_DOCDIR%%/qtopengl/style/offline-simple.css
%%QT_DOCDIR%%/qtopengl/style/offline.css
%%QT_DOCDIR%%/qtplatformheaders.qch
%%QT_DOCDIR%%/qtplatformheaders/images/arrow_bc.png
%%QT_DOCDIR%%/qtplatformheaders/images/bgrContent.png
%%QT_DOCDIR%%/qtplatformheaders/images/btn_next.png
%%QT_DOCDIR%%/qtplatformheaders/images/btn_prev.png
%%QT_DOCDIR%%/qtplatformheaders/images/bullet_dn.png
%%QT_DOCDIR%%/qtplatformheaders/images/bullet_sq.png
%%QT_DOCDIR%%/qtplatformheaders/images/home.png
%%QT_DOCDIR%%/qtplatformheaders/images/ico_note.png
%%QT_DOCDIR%%/qtplatformheaders/images/ico_note_attention.png
%%QT_DOCDIR%%/qtplatformheaders/images/ico_out.png
%%QT_DOCDIR%%/qtplatformheaders/images/logo.png
%%QT_DOCDIR%%/qtplatformheaders/qcocoanativecontext-members.html
%%QT_DOCDIR%%/qtplatformheaders/qcocoanativecontext.html
%%QT_DOCDIR%%/qtplatformheaders/qcocoawindowfunctions-members.html
%%QT_DOCDIR%%/qtplatformheaders/qcocoawindowfunctions.html
%%QT_DOCDIR%%/qtplatformheaders/qeglfsfunctions-members.html
%%QT_DOCDIR%%/qtplatformheaders/qeglfsfunctions.html
%%QT_DOCDIR%%/qtplatformheaders/qeglnativecontext-members.html
%%QT_DOCDIR%%/qtplatformheaders/qeglnativecontext.html
%%QT_DOCDIR%%/qtplatformheaders/qglxnativecontext-members.html
%%QT_DOCDIR%%/qtplatformheaders/qglxnativecontext.html
%%QT_DOCDIR%%/qtplatformheaders/qtplatformheaders-index.html
%%QT_DOCDIR%%/qtplatformheaders/qtplatformheaders-module.html
%%QT_DOCDIR%%/qtplatformheaders/qtplatformheaders.index
%%QT_DOCDIR%%/qtplatformheaders/qtplatformheaders.qhp
%%QT_DOCDIR%%/qtplatformheaders/qtplatformheaders.qhp.sha1
%%QT_DOCDIR%%/qtplatformheaders/qwglnativecontext-members.html
%%QT_DOCDIR%%/qtplatformheaders/qwglnativecontext.html
%%QT_DOCDIR%%/qtplatformheaders/qwindowswindowfunctions-members.html
%%QT_DOCDIR%%/qtplatformheaders/qwindowswindowfunctions.html
%%QT_DOCDIR%%/qtplatformheaders/qxcbwindowfunctions-members.html
%%QT_DOCDIR%%/qtplatformheaders/qxcbwindowfunctions.html
%%QT_DOCDIR%%/qtplatformheaders/style/offline-simple.css
%%QT_DOCDIR%%/qtplatformheaders/style/offline.css
%%QT_DOCDIR%%/qtpositioning.qch
%%QT_DOCDIR%%/qtpositioning/examples-manifest.xml
%%QT_DOCDIR%%/qtpositioning/images/arrow_bc.png
%%QT_DOCDIR%%/qtpositioning/images/bgrContent.png
%%QT_DOCDIR%%/qtpositioning/images/btn_next.png
%%QT_DOCDIR%%/qtpositioning/images/btn_prev.png
%%QT_DOCDIR%%/qtpositioning/images/bullet_dn.png
%%QT_DOCDIR%%/qtpositioning/images/bullet_sq.png
%%QT_DOCDIR%%/qtpositioning/images/example-satelliteinfo.png
%%QT_DOCDIR%%/qtpositioning/images/example-weatherinfo.png
%%QT_DOCDIR%%/qtpositioning/images/home.png
%%QT_DOCDIR%%/qtpositioning/images/ico_note.png
%%QT_DOCDIR%%/qtpositioning/images/ico_note_attention.png
%%QT_DOCDIR%%/qtpositioning/images/ico_out.png
%%QT_DOCDIR%%/qtpositioning/images/logo.png
%%QT_DOCDIR%%/qtpositioning/images/qml-flickr-1.jpg
%%QT_DOCDIR%%/qtpositioning/location-positioning-cpp.html
%%QT_DOCDIR%%/qtpositioning/location-positioning-qml.html
%%QT_DOCDIR%%/qtpositioning/positioning-cpp-qml.html
%%QT_DOCDIR%%/qtpositioning/qgeoaddress-members.html
%%QT_DOCDIR%%/qtpositioning/qgeoaddress.html
%%QT_DOCDIR%%/qtpositioning/qgeoareamonitorinfo-members.html
%%QT_DOCDIR%%/qtpositioning/qgeoareamonitorinfo.html
%%QT_DOCDIR%%/qtpositioning/qgeoareamonitorsource-members.html
%%QT_DOCDIR%%/qtpositioning/qgeoareamonitorsource.html
%%QT_DOCDIR%%/qtpositioning/qgeocircle-members.html
%%QT_DOCDIR%%/qtpositioning/qgeocircle.html
%%QT_DOCDIR%%/qtpositioning/qgeocoordinate-members.html
%%QT_DOCDIR%%/qtpositioning/qgeocoordinate.html
%%QT_DOCDIR%%/qtpositioning/qgeolocation-members.html
%%QT_DOCDIR%%/qtpositioning/qgeolocation.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfo-members.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfo.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfosource-members.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfosource.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfosourcefactory-members.html
%%QT_DOCDIR%%/qtpositioning/qgeopositioninfosourcefactory.html
%%QT_DOCDIR%%/qtpositioning/qgeorectangle-members.html
%%QT_DOCDIR%%/qtpositioning/qgeorectangle.html
%%QT_DOCDIR%%/qtpositioning/qgeosatelliteinfo-members.html
%%QT_DOCDIR%%/qtpositioning/qgeosatelliteinfo.html
%%QT_DOCDIR%%/qtpositioning/qgeosatelliteinfosource-members.html
%%QT_DOCDIR%%/qtpositioning/qgeosatelliteinfosource.html
%%QT_DOCDIR%%/qtpositioning/qgeoshape-members.html
%%QT_DOCDIR%%/qtpositioning/qgeoshape.html
%%QT_DOCDIR%%/qtpositioning/qml-coordinate.html
%%QT_DOCDIR%%/qtpositioning/qml-geocircle.html
%%QT_DOCDIR%%/qtpositioning/qml-georectangle.html
%%QT_DOCDIR%%/qtpositioning/qml-geoshape.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-address-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-address.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-coordinateanimation.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-location-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-location.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-position-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-position.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-positionsource-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-positionsource.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-qtpositioning-members.html
%%QT_DOCDIR%%/qtpositioning/qml-qtpositioning-qtpositioning.html
%%QT_DOCDIR%%/qtpositioning/qnmeapositioninfosource-members.html
%%QT_DOCDIR%%/qtpositioning/qnmeapositioninfosource.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-examples.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-example.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickr-90-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickr-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickr-qrc.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrcommon-progress-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrcommon-slider-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-button-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-geotab-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-geoflickr-pro.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-geoflickr-qmlproject.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-geoflickr-qmllocationflickr-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-index.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-h.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-example.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-logfile-qrc.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-h.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-logfilepositionsource-main-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-module.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-plugins.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-qmlmodule.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-example.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-main-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-pro.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qrc.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-h.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-appmodel-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-appmodel-h.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-components-bigforecasticon-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-components-forecasticon-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-components-weathericon-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-example.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-main-cpp.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-weatherinfo-pro.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qml.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qrc.html
%%QT_DOCDIR%%/qtpositioning/qtpositioning.index
%%QT_DOCDIR%%/qtpositioning/qtpositioning.qhp
%%QT_DOCDIR%%/qtpositioning/qtpositioning.qhp.sha1
%%QT_DOCDIR%%/qtpositioning/qtpositioning.tags
%%QT_DOCDIR%%/qtpositioning/style/offline-simple.css
%%QT_DOCDIR%%/qtpositioning/style/offline.css
%%QT_DOCDIR%%/qtprintsupport.qch
%%QT_DOCDIR%%/qtprintsupport/images/arrow_bc.png
%%QT_DOCDIR%%/qtprintsupport/images/bgrContent.png
%%QT_DOCDIR%%/qtprintsupport/images/btn_next.png
%%QT_DOCDIR%%/qtprintsupport/images/btn_prev.png
%%QT_DOCDIR%%/qtprintsupport/images/bullet_dn.png
%%QT_DOCDIR%%/qtprintsupport/images/bullet_sq.png
%%QT_DOCDIR%%/qtprintsupport/images/home.png
%%QT_DOCDIR%%/qtprintsupport/images/ico_note.png
%%QT_DOCDIR%%/qtprintsupport/images/ico_note_attention.png
%%QT_DOCDIR%%/qtprintsupport/images/ico_out.png
%%QT_DOCDIR%%/qtprintsupport/images/logo.png
%%QT_DOCDIR%%/qtprintsupport/images/plastique-printdialog-properties.png
%%QT_DOCDIR%%/qtprintsupport/images/plastique-printdialog.png
%%QT_DOCDIR%%/qtprintsupport/images/printer-rects.png
%%QT_DOCDIR%%/qtprintsupport/pdf-licensing.html
%%QT_DOCDIR%%/qtprintsupport/printing.html
%%QT_DOCDIR%%/qtprintsupport/qabstractprintdialog-members.html
%%QT_DOCDIR%%/qtprintsupport/qabstractprintdialog-obsolete.html
%%QT_DOCDIR%%/qtprintsupport/qabstractprintdialog.html
%%QT_DOCDIR%%/qtprintsupport/qpagesetupdialog-members.html
%%QT_DOCDIR%%/qtprintsupport/qpagesetupdialog.html
%%QT_DOCDIR%%/qtprintsupport/qprintdialog-members.html
%%QT_DOCDIR%%/qtprintsupport/qprintdialog.html
%%QT_DOCDIR%%/qtprintsupport/qprintengine-members.html
%%QT_DOCDIR%%/qtprintsupport/qprintengine.html
%%QT_DOCDIR%%/qtprintsupport/qprinter-members.html
%%QT_DOCDIR%%/qtprintsupport/qprinter-obsolete.html
%%QT_DOCDIR%%/qtprintsupport/qprinter.html
%%QT_DOCDIR%%/qtprintsupport/qprinterinfo-members.html
%%QT_DOCDIR%%/qtprintsupport/qprinterinfo-obsolete.html
%%QT_DOCDIR%%/qtprintsupport/qprinterinfo.html
%%QT_DOCDIR%%/qtprintsupport/qprintpreviewdialog-members.html
%%QT_DOCDIR%%/qtprintsupport/qprintpreviewdialog.html
%%QT_DOCDIR%%/qtprintsupport/qprintpreviewwidget-members.html
%%QT_DOCDIR%%/qtprintsupport/qprintpreviewwidget.html
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport-index.html
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport-module.html
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport.index
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport.qhp
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport.qhp.sha1
%%QT_DOCDIR%%/qtprintsupport/qtprintsupport.tags
%%QT_DOCDIR%%/qtprintsupport/style/offline-simple.css
%%QT_DOCDIR%%/qtprintsupport/style/offline.css
%%QT_DOCDIR%%/qtpurchasing.qch
%%QT_DOCDIR%%/qtpurchasing/examples-manifest.xml
%%QT_DOCDIR%%/qtpurchasing/images/arrow_bc.png
%%QT_DOCDIR%%/qtpurchasing/images/bgrContent.png
%%QT_DOCDIR%%/qtpurchasing/images/btn_next.png
%%QT_DOCDIR%%/qtpurchasing/images/btn_prev.png
%%QT_DOCDIR%%/qtpurchasing/images/bullet_dn.png
%%QT_DOCDIR%%/qtpurchasing/images/bullet_sq.png
%%QT_DOCDIR%%/qtpurchasing/images/home.png
%%QT_DOCDIR%%/qtpurchasing/images/ico_note.png
%%QT_DOCDIR%%/qtpurchasing/images/ico_note_attention.png
%%QT_DOCDIR%%/qtpurchasing/images/ico_out.png
%%QT_DOCDIR%%/qtpurchasing/images/logo.png
%%QT_DOCDIR%%/qtpurchasing/images/qthangman-example.png
%%QT_DOCDIR%%/qtpurchasing/images/qthangman-store-example.png
%%QT_DOCDIR%%/qtpurchasing/qinappproduct-members.html
%%QT_DOCDIR%%/qtpurchasing/qinappproduct.html
%%QT_DOCDIR%%/qtpurchasing/qinappstore-members.html
%%QT_DOCDIR%%/qtpurchasing/qinappstore.html
%%QT_DOCDIR%%/qtpurchasing/qinapptransaction-members.html
%%QT_DOCDIR%%/qtpurchasing/qinapptransaction.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-product-members.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-product.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-store-members.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-store.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-transaction-members.html
%%QT_DOCDIR%%/qtpurchasing/qml-qtpurchasing-transaction.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-appstore.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-examples.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-gettingstarted-cpp.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-gettingstarted-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-googleplay.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-index.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-module.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qmlmodule.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-example.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-hangmangame-cpp.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-hangmangame-h.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-main-cpp.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-gameview-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-guesswordview-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-hangman-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-howtoview-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-key-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-letter-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-letterselector-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-main-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-mainview-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-pageheader-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-scoreitem-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-simplebutton-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-splashscreen-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-storeitem-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-storeview-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qml-qthangman-word-qml.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-qthangman-pro.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing-qthangman-resources-qrc.html
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing.index
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing.qhp
%%QT_DOCDIR%%/qtpurchasing/qtpurchasing.qhp.sha1
%%QT_DOCDIR%%/qtpurchasing/style/offline-simple.css
%%QT_DOCDIR%%/qtpurchasing/style/offline.css
%%QT_DOCDIR%%/qtqml.qch
%%QT_DOCDIR%%/qtqml/examples-manifest.xml
%%QT_DOCDIR%%/qtqml/images/arrow_bc.png
%%QT_DOCDIR%%/qtqml/images/bgrContent.png
%%QT_DOCDIR%%/qtqml/images/btn_next.png
%%QT_DOCDIR%%/qtqml/images/btn_prev.png
%%QT_DOCDIR%%/qtqml/images/bullet_dn.png
%%QT_DOCDIR%%/qtqml/images/bullet_sq.png
%%QT_DOCDIR%%/qtqml/images/button-types.png
%%QT_DOCDIR%%/qtqml/images/declarative-rect_tint.png
%%QT_DOCDIR%%/qtqml/images/documents-definetypes-attributes.png
%%QT_DOCDIR%%/qtqml/images/documents-definetypes-simple.png
%%QT_DOCDIR%%/qtqml/images/extending-tutorial-chapter1.png
%%QT_DOCDIR%%/qtqml/images/extending-tutorial-chapter2.png
%%QT_DOCDIR%%/qtqml/images/extending-tutorial-chapter3.png
%%QT_DOCDIR%%/qtqml/images/extending-tutorial-chapter5.png
%%QT_DOCDIR%%/qtqml/images/home.png
%%QT_DOCDIR%%/qtqml/images/ico_note.png
%%QT_DOCDIR%%/qtqml/images/ico_note_attention.png
%%QT_DOCDIR%%/qtqml/images/ico_out.png
%%QT_DOCDIR%%/qtqml/images/listmodel-nested.png
%%QT_DOCDIR%%/qtqml/images/listmodel.png
%%QT_DOCDIR%%/qtqml/images/logo.png
%%QT_DOCDIR%%/qtqml/images/qml-dynamicscene-example.png
%%QT_DOCDIR%%/qtqml/images/qml-i18n-example.png
%%QT_DOCDIR%%/qtqml/images/qml-plugins-example.png
%%QT_DOCDIR%%/qtqml/images/qml-xmlhttprequest-example.png
%%QT_DOCDIR%%/qtqml/images/qtqml-syntax-basics-object-declaration.png
%%QT_DOCDIR%%/qtqml/images/statemachine-button-history.png
%%QT_DOCDIR%%/qtqml/images/statemachine-button-nested.png
%%QT_DOCDIR%%/qtqml/images/statemachine-button.png
%%QT_DOCDIR%%/qtqml/images/statemachine-finished.png
%%QT_DOCDIR%%/qtqml/images/statemachine-nonparallel.png
%%QT_DOCDIR%%/qtqml/images/statemachine-parallel.png
%%QT_DOCDIR%%/qtqml/images/visualitemmodel.png
%%QT_DOCDIR%%/qtqml/qjsengine-members.html
%%QT_DOCDIR%%/qtqml/qjsengine-obsolete.html
%%QT_DOCDIR%%/qtqml/qjsengine.html
%%QT_DOCDIR%%/qtqml/qjsvalue-members.html
%%QT_DOCDIR%%/qtqml/qjsvalue-obsolete.html
%%QT_DOCDIR%%/qtqml/qjsvalue.html
%%QT_DOCDIR%%/qtqml/qjsvalueiterator-members.html
%%QT_DOCDIR%%/qtqml/qjsvalueiterator.html
%%QT_DOCDIR%%/qtqml/qml-bool.html
%%QT_DOCDIR%%/qtqml/qml-date.html
%%QT_DOCDIR%%/qtqml/qml-double.html
%%QT_DOCDIR%%/qtqml/qml-enumeration.html
%%QT_DOCDIR%%/qtqml/qml-int.html
%%QT_DOCDIR%%/qtqml/qml-list.html
%%QT_DOCDIR%%/qtqml/qml-package-members.html
%%QT_DOCDIR%%/qtqml/qml-package.html
%%QT_DOCDIR%%/qtqml/qml-point.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-binding-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-binding.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-component-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-component.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-connections-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-connections.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-date-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-date.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-instantiator-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-instantiator.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-locale-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-locale.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-delegatemodel-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-delegatemodel.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-delegatemodelgroup.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-itemselectionmodel-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-itemselectionmodel.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-listelement-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-listelement.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-listmodel-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-listmodel.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-objectmodel-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-models-objectmodel.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-number-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-number.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-qt-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-qt.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-qtobject-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-qtobject.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-finalstate-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-finalstate.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-historystate-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-historystate.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qabstractstate.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qabstracttransition.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-qsignaltransition.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-signaltransition-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-signaltransition.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-state-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-state.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-statemachine-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-statemachine.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-statemachine-timeouttransition.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-string-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-string.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-timer-members.html
%%QT_DOCDIR%%/qtqml/qml-qtqml-timer.html
%%QT_DOCDIR%%/qtqml/qml-real.html
%%QT_DOCDIR%%/qtqml/qml-rect.html
%%QT_DOCDIR%%/qtqml/qml-size.html
%%QT_DOCDIR%%/qtqml/qml-string.html
%%QT_DOCDIR%%/qtqml/qml-url.html
%%QT_DOCDIR%%/qtqml/qml-var.html
%%QT_DOCDIR%%/qtqml/qml-variant.html
%%QT_DOCDIR%%/qtqml/qml-visualdatagroup-members.html
%%QT_DOCDIR%%/qtqml/qml-visualdatagroup.html
%%QT_DOCDIR%%/qtqml/qml-visualdatamodel-members.html
%%QT_DOCDIR%%/qtqml/qml-visualdatamodel.html
%%QT_DOCDIR%%/qtqml/qml-visualitemmodel-members.html
%%QT_DOCDIR%%/qtqml/qml-visualitemmodel.html
%%QT_DOCDIR%%/qtqml/qml-workerscript-members.html
%%QT_DOCDIR%%/qtqml/qml-workerscript.html
%%QT_DOCDIR%%/qtqml/qmlextendingexamples.html
%%QT_DOCDIR%%/qtqml/qmlreference.html
%%QT_DOCDIR%%/qtqml/qmlstatemachine.html
%%QT_DOCDIR%%/qtqml/qmodelindex-and-related-classes-in-qml.html
%%QT_DOCDIR%%/qtqml/qqmlabstracturlinterceptor-members.html
%%QT_DOCDIR%%/qtqml/qqmlabstracturlinterceptor.html
%%QT_DOCDIR%%/qtqml/qqmlapplicationengine-members.html
%%QT_DOCDIR%%/qtqml/qqmlapplicationengine.html
%%QT_DOCDIR%%/qtqml/qqmlcomponent-members.html
%%QT_DOCDIR%%/qtqml/qqmlcomponent.html
%%QT_DOCDIR%%/qtqml/qqmlcontext-members.html
%%QT_DOCDIR%%/qtqml/qqmlcontext.html
%%QT_DOCDIR%%/qtqml/qqmlengine-members.html
%%QT_DOCDIR%%/qtqml/qqmlengine.html
%%QT_DOCDIR%%/qtqml/qqmlerror-members.html
%%QT_DOCDIR%%/qtqml/qqmlerror.html
%%QT_DOCDIR%%/qtqml/qqmlexpression-members.html
%%QT_DOCDIR%%/qtqml/qqmlexpression.html
%%QT_DOCDIR%%/qtqml/qqmlextensionplugin-members.html
%%QT_DOCDIR%%/qtqml/qqmlextensionplugin.html
%%QT_DOCDIR%%/qtqml/qqmlfileselector-members.html
%%QT_DOCDIR%%/qtqml/qqmlfileselector.html
%%QT_DOCDIR%%/qtqml/qqmlimageproviderbase-members.html
%%QT_DOCDIR%%/qtqml/qqmlimageproviderbase.html
%%QT_DOCDIR%%/qtqml/qqmlincubationcontroller-members.html
%%QT_DOCDIR%%/qtqml/qqmlincubationcontroller.html
%%QT_DOCDIR%%/qtqml/qqmlincubator-members.html
%%QT_DOCDIR%%/qtqml/qqmlincubator.html
%%QT_DOCDIR%%/qtqml/qqmllistproperty-members.html
%%QT_DOCDIR%%/qtqml/qqmllistproperty.html
%%QT_DOCDIR%%/qtqml/qqmllistreference-members.html
%%QT_DOCDIR%%/qtqml/qqmllistreference.html
%%QT_DOCDIR%%/qtqml/qqmlnetworkaccessmanagerfactory-members.html
%%QT_DOCDIR%%/qtqml/qqmlnetworkaccessmanagerfactory.html
%%QT_DOCDIR%%/qtqml/qqmlparserstatus-members.html
%%QT_DOCDIR%%/qtqml/qqmlparserstatus.html
%%QT_DOCDIR%%/qtqml/qqmlproperty-members.html
%%QT_DOCDIR%%/qtqml/qqmlproperty.html
%%QT_DOCDIR%%/qtqml/qqmlpropertymap-members.html
%%QT_DOCDIR%%/qtqml/qqmlpropertymap.html
%%QT_DOCDIR%%/qtqml/qqmlpropertyvaluesource-members.html
%%QT_DOCDIR%%/qtqml/qqmlpropertyvaluesource.html
%%QT_DOCDIR%%/qtqml/qqmlscriptstring-members.html
%%QT_DOCDIR%%/qtqml/qqmlscriptstring.html
%%QT_DOCDIR%%/qtqml/qtjavascript.html
%%QT_DOCDIR%%/qtqml/qtqml-cppclasses-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-contextproperties.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-data.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-definetypes.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-exposecppattributes.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
%%QT_DOCDIR%%/qtqml/qtqml-cppintegration-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-documents-definetypes.html
%%QT_DOCDIR%%/qtqml/qtqml-documents-networktransparency.html
%%QT_DOCDIR%%/qtqml/qtqml-documents-scope.html
%%QT_DOCDIR%%/qtqml/qtqml-documents-structure.html
%%QT_DOCDIR%%/qtqml/qtqml-documents-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-button-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-genericsceneitem-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-itemcreation-js.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-paletteitem-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-perspectiveitem-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-content-sun-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-dynamicscene-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-dynamicscene-qmlproject.html
%%QT_DOCDIR%%/qtqml/qtqml-dynamicscene-example.html
%%QT_DOCDIR%%/qtqml/qtqml-index.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-dynamicobjectcreation.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-expressions.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-functionlist.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-hostenvironment.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-imports.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-qmlglobalobject.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-resources.html
%%QT_DOCDIR%%/qtqml/qtqml-javascript-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-models-qmlmodule.html
%%QT_DOCDIR%%/qtqml/qtqml-module.html
%%QT_DOCDIR%%/qtqml/qtqml-modules-cppplugins.html
%%QT_DOCDIR%%/qtqml/qtqml-modules-identifiedmodules.html
%%QT_DOCDIR%%/qtqml/qtqml-modules-legacymodules.html
%%QT_DOCDIR%%/qtqml/qtqml-modules-qmldir.html
%%QT_DOCDIR%%/qtqml/qtqml-modules-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-example.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-networkaccessmanagerfactory-view-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-qml-i18n-example.html
%%QT_DOCDIR%%/qtqml/qtqml-qml-i18n-qml-i18n-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-qml-i18n-qml-i18n-qmlproject.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-example.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-plugin-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-plugins-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-plugins-qmlproject.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-qmlmodule.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-adding-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-adding-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-adding-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-attached-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-attached-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-attached-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-binding-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-binding-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-binding-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-coercion-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-coercion-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-coercion-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-default-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-default-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-default-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-extended-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-extended-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-lineedit-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-lineedit-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-extended-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-grouped-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-grouped-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-grouped-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-methods-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-methods-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-methods-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-properties-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-properties-properties-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-signal-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-signal-signal-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-example-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-example.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-person-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-person-h.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-valuesource-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-referenceexamples-valuesource-valuesource-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-statemachine-qmlmodule.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-basics.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-directoryimports.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-imports.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-objectattributes.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-propertybinding.html
%%QT_DOCDIR%%/qtqml/qtqml-syntax-signals.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-example.html
%%QT_DOCDIR%%/qtqml/qtqml-tutorials-extending-qml-extending-qml-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-typesystem-basictypes.html
%%QT_DOCDIR%%/qtqml/qtqml-typesystem-objecttypes.html
%%QT_DOCDIR%%/qtqml/qtqml-typesystem-topic.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-data-xml.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-example.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-get-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-main-cpp.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-xmlhttprequest-pro.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qml.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
%%QT_DOCDIR%%/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qrc.html
%%QT_DOCDIR%%/qtqml/qtqml.index
%%QT_DOCDIR%%/qtqml/qtqml.qhp
%%QT_DOCDIR%%/qtqml/qtqml.qhp.sha1
%%QT_DOCDIR%%/qtqml/qtqml.tags
%%QT_DOCDIR%%/qtqml/style/offline-simple.css
%%QT_DOCDIR%%/qtqml/style/offline.css
%%QT_DOCDIR%%/qtquick.qch
%%QT_DOCDIR%%/qtquick/demos-manifest.xml
%%QT_DOCDIR%%/qtquick/examples-manifest.xml
%%QT_DOCDIR%%/qtquick/images/3d-rotation-axis.png
%%QT_DOCDIR%%/qtquick/images/ListViewHorizontal.png
%%QT_DOCDIR%%/qtquick/images/anchor_ordering.png
%%QT_DOCDIR%%/qtquick/images/anchor_ordering_bad.png
%%QT_DOCDIR%%/qtquick/images/anchorchanges.png
%%QT_DOCDIR%%/qtquick/images/animatedimageitem.gif
%%QT_DOCDIR%%/qtquick/images/arrow_bc.png
%%QT_DOCDIR%%/qtquick/images/axisrotation.png
%%QT_DOCDIR%%/qtquick/images/bgrContent.png
%%QT_DOCDIR%%/qtquick/images/btn_next.png
%%QT_DOCDIR%%/qtquick/images/btn_prev.png
%%QT_DOCDIR%%/qtquick/images/bullet_dn.png
%%QT_DOCDIR%%/qtquick/images/bullet_sq.png
%%QT_DOCDIR%%/qtquick/images/columnlayout.png
%%QT_DOCDIR%%/qtquick/images/custom-geometry-example.png
%%QT_DOCDIR%%/qtquick/images/declarative-adv-tutorial1.png
%%QT_DOCDIR%%/qtquick/images/declarative-adv-tutorial2.png
%%QT_DOCDIR%%/qtquick/images/declarative-adv-tutorial3.png
%%QT_DOCDIR%%/qtquick/images/declarative-adv-tutorial4.gif
%%QT_DOCDIR%%/qtquick/images/declarative-anchors_example.png
%%QT_DOCDIR%%/qtquick/images/declarative-anchors_example2.png
%%QT_DOCDIR%%/qtquick/images/declarative-arcdirection.png
%%QT_DOCDIR%%/qtquick/images/declarative-arcradius.png
%%QT_DOCDIR%%/qtquick/images/declarative-colors.png
%%QT_DOCDIR%%/qtquick/images/declarative-gridmesh.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_opacity1.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_opacity2.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_stacking1.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_stacking2.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_stacking3.png
%%QT_DOCDIR%%/qtquick/images/declarative-item_stacking4.png
%%QT_DOCDIR%%/qtquick/images/declarative-largearc.png
%%QT_DOCDIR%%/qtquick/images/declarative-nopercent.png
%%QT_DOCDIR%%/qtquick/images/declarative-patharc.png
%%QT_DOCDIR%%/qtquick/images/declarative-pathattribute.png
%%QT_DOCDIR%%/qtquick/images/declarative-pathcubic.png
%%QT_DOCDIR%%/qtquick/images/declarative-pathcurve.png
%%QT_DOCDIR%%/qtquick/images/declarative-pathquad.png
%%QT_DOCDIR%%/qtquick/images/declarative-pathsvg.png
%%QT_DOCDIR%%/qtquick/images/declarative-percent.png
%%QT_DOCDIR%%/qtquick/images/declarative-qmlfocus1.png
%%QT_DOCDIR%%/qtquick/images/declarative-qmlfocus2.png
%%QT_DOCDIR%%/qtquick/images/declarative-qmlfocus3.png
%%QT_DOCDIR%%/qtquick/images/declarative-qmlfocus4.png
%%QT_DOCDIR%%/qtquick/images/declarative-qmlfocus5.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-preserveaspectfit.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-stretch.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-tile.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-tilehorizontally.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo-tilevertically.png
%%QT_DOCDIR%%/qtquick/images/declarative-qtlogo.png
%%QT_DOCDIR%%/qtquick/images/declarative-rect.png
%%QT_DOCDIR%%/qtquick/images/declarative-rect_gradient.png
%%QT_DOCDIR%%/qtquick/images/declarative-rotation.png
%%QT_DOCDIR%%/qtquick/images/declarative-samegame.png
%%QT_DOCDIR%%/qtquick/images/declarative-scale.png
%%QT_DOCDIR%%/qtquick/images/declarative-scalegrid.png
%%QT_DOCDIR%%/qtquick/images/declarative-shadereffectitem.png
%%QT_DOCDIR%%/qtquick/images/declarative-shadereffectsource.png
%%QT_DOCDIR%%/qtquick/images/declarative-text.png
%%QT_DOCDIR%%/qtquick/images/declarative-textballoons_example.png
%%QT_DOCDIR%%/qtquick/images/declarative-textedit.gif
%%QT_DOCDIR%%/qtquick/images/declarative-textformat.png
%%QT_DOCDIR%%/qtquick/images/declarative-textstyle.png
%%QT_DOCDIR%%/qtquick/images/declarative-transformorigin.png
%%QT_DOCDIR%%/qtquick/images/declarative-tutorial1.png
%%QT_DOCDIR%%/qtquick/images/declarative-tutorial2.png
%%QT_DOCDIR%%/qtquick/images/declarative-tutorial3_animation.gif
%%QT_DOCDIR%%/qtquick/images/edge1.png
%%QT_DOCDIR%%/qtquick/images/edge2.png
%%QT_DOCDIR%%/qtquick/images/edge3.png
%%QT_DOCDIR%%/qtquick/images/edge4.png
%%QT_DOCDIR%%/qtquick/images/edges_qml.png
%%QT_DOCDIR%%/qtquick/images/flickable-rebound.gif
%%QT_DOCDIR%%/qtquick/images/flickable.gif
%%QT_DOCDIR%%/qtquick/images/flipable.gif
%%QT_DOCDIR%%/qtquick/images/fuzzydot.png
%%QT_DOCDIR%%/qtquick/images/glowdot.png
%%QT_DOCDIR%%/qtquick/images/graph-example.jpg
%%QT_DOCDIR%%/qtquick/images/gridLayout_aligncenter.png
%%QT_DOCDIR%%/qtquick/images/gridLayout_aligntop.png
%%QT_DOCDIR%%/qtquick/images/gridLayout_aligntopleft.png
%%QT_DOCDIR%%/qtquick/images/gridLayout_example.png
%%QT_DOCDIR%%/qtquick/images/gridlayout.png
%%QT_DOCDIR%%/qtquick/images/gridview-highlight.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
%%QT_DOCDIR%%/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
%%QT_DOCDIR%%/qtquick/images/gridview-simple.png
%%QT_DOCDIR%%/qtquick/images/home.png
%%QT_DOCDIR%%/qtquick/images/horizontalpositioner_example.png
%%QT_DOCDIR%%/qtquick/images/ico_note.png
%%QT_DOCDIR%%/qtquick/images/ico_note_attention.png
%%QT_DOCDIR%%/qtquick/images/ico_out.png
%%QT_DOCDIR%%/qtquick/images/imageprovider.png
%%QT_DOCDIR%%/qtquick/images/layoutmirroring.png
%%QT_DOCDIR%%/qtquick/images/listview-decorations.png
%%QT_DOCDIR%%/qtquick/images/listview-highlight.png
%%QT_DOCDIR%%/qtquick/images/listview-layout-bottomtotop.png
%%QT_DOCDIR%%/qtquick/images/listview-layout-lefttoright.png
%%QT_DOCDIR%%/qtquick/images/listview-layout-righttoleft.png
%%QT_DOCDIR%%/qtquick/images/listview-layout-toptobottom.png
%%QT_DOCDIR%%/qtquick/images/listview-section.png
%%QT_DOCDIR%%/qtquick/images/listview-setup.png
%%QT_DOCDIR%%/qtquick/images/listview-simple.png
%%QT_DOCDIR%%/qtquick/images/logo.png
%%QT_DOCDIR%%/qtquick/images/manual-layout.png
%%QT_DOCDIR%%/qtquick/images/margins_qml.png
%%QT_DOCDIR%%/qtquick/images/mob-idle.png
%%QT_DOCDIR%%/qtquick/images/modelview-overview.png
%%QT_DOCDIR%%/qtquick/images/openglunderqml-example.jpg
%%QT_DOCDIR%%/qtquick/images/parentchange.png
%%QT_DOCDIR%%/qtquick/images/pathview.gif
%%QT_DOCDIR%%/qtquick/images/positioner-example.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inback.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inbounce.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-incirc.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-incubic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inelastic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inexpo.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutback.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutbounce.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutcirc.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutcubic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutelastic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutexpo.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutquad.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutquart.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutquint.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inoutsine.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inquad.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inquart.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-inquint.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-insine.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-linear.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outback.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outbounce.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outcirc.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outcubic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outelastic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outexpo.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinback.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinbounce.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outincirc.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outincubic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinelastic.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinexpo.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinquad.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinquart.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinquint.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outinsine.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outquad.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outquart.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outquint.png
%%QT_DOCDIR%%/qtquick/images/qeasingcurve-outsine.png
%%QT_DOCDIR%%/qtquick/images/qml-abstractitemmodel-example.png
%%QT_DOCDIR%%/qtquick/images/qml-affectors-example.png
%%QT_DOCDIR%%/qtquick/images/qml-animations-example.png
%%QT_DOCDIR%%/qtquick/images/qml-blending-layered.png
%%QT_DOCDIR%%/qtquick/images/qml-blending-nonlayered.png
%%QT_DOCDIR%%/qtquick/images/qml-borderimage-normal-image.png
%%QT_DOCDIR%%/qtquick/images/qml-borderimage-scaled.png
%%QT_DOCDIR%%/qtquick/images/qml-borderimage-tiled.png
%%QT_DOCDIR%%/qtquick/images/qml-canvas-example.png
%%QT_DOCDIR%%/qtquick/images/qml-column.png
%%QT_DOCDIR%%/qtquick/images/qml-customparticle-example.png
%%QT_DOCDIR%%/qtquick/images/qml-dialcontrol-example.png
%%QT_DOCDIR%%/qtquick/images/qml-dnd2-example.png
%%QT_DOCDIR%%/qtquick/images/qml-draganddrop-example.png
%%QT_DOCDIR%%/qtquick/images/qml-emitters-example.png
%%QT_DOCDIR%%/qtquick/images/qml-flipable-example.png
%%QT_DOCDIR%%/qtquick/images/qml-flow-snippet.png
%%QT_DOCDIR%%/qtquick/images/qml-flow-text1.png
%%QT_DOCDIR%%/qtquick/images/qml-flow-text2.png
%%QT_DOCDIR%%/qtquick/images/qml-gradient.png
%%QT_DOCDIR%%/qtquick/images/qml-grid-no-spacing.png
%%QT_DOCDIR%%/qtquick/images/qml-grid-spacing.png
%%QT_DOCDIR%%/qtquick/images/qml-imageelements-example.png
%%QT_DOCDIR%%/qtquick/images/qml-imageparticle-example.png
%%QT_DOCDIR%%/qtquick/images/qml-imageprovider-example.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-arc.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-arcTo.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-bezierCurveTo.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-clip-complex.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-context.gif
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-math-rotate.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-math.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-rotate.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-scale.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-scalex.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-scaley.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-skewx.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-skewy.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-startAngle.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-translate.png
%%QT_DOCDIR%%/qtquick/images/qml-item-canvas-translatey.png
%%QT_DOCDIR%%/qtquick/images/qml-keyinteraction-example.png
%%QT_DOCDIR%%/qtquick/images/qml-listview-sections-example.png
%%QT_DOCDIR%%/qtquick/images/qml-localstorage-example.png
%%QT_DOCDIR%%/qtquick/images/qml-modelviews-example.png
%%QT_DOCDIR%%/qtquick/images/qml-mousearea-example.png
%%QT_DOCDIR%%/qtquick/images/qml-mousearea-snippet.png
%%QT_DOCDIR%%/qtquick/images/qml-objectlistmodel-example.png
%%QT_DOCDIR%%/qtquick/images/qml-positioners-example.png
%%QT_DOCDIR%%/qtquick/images/qml-righttoleft-example.png
%%QT_DOCDIR%%/qtquick/images/qml-row.png
%%QT_DOCDIR%%/qtquick/images/qml-scrollbar-example.png
%%QT_DOCDIR%%/qtquick/images/qml-shadereffect-layereffect.png
%%QT_DOCDIR%%/qtquick/images/qml-shadereffect-nolayereffect.png
%%QT_DOCDIR%%/qtquick/images/qml-shadereffect-opacitymask.png
%%QT_DOCDIR%%/qtquick/images/qml-shadereffects-example.png
%%QT_DOCDIR%%/qtquick/images/qml-stringlistmodel-example.png
%%QT_DOCDIR%%/qtquick/images/qml-system-example.png
%%QT_DOCDIR%%/qtquick/images/qml-tabwidget-example.png
%%QT_DOCDIR%%/qtquick/images/qml-text-example.png
%%QT_DOCDIR%%/qtquick/images/qml-threading-example.png
%%QT_DOCDIR%%/qtquick/images/qml-touchinteraction-example.png
%%QT_DOCDIR%%/qtquick/images/qml-window-example.png
%%QT_DOCDIR%%/qtquick/images/qml-xmllistmodel-example.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-calqlatr.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-clocks-small.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-1.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-2.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-3.jpg
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-4.jpg
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-5.jpg
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-maroon-med-6.jpg
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-photosurface-small.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-photoviewer-small.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-rssnews-small.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-samegame-med-1.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-samegame-med-2.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-stocqt.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-tweetsearch-med-1.png
%%QT_DOCDIR%%/qtquick/images/qtquick-demo-tweetsearch-med-2.png
%%QT_DOCDIR%%/qtquick/images/qtquicklayouts-example-layouts.png
%%QT_DOCDIR%%/qtquick/images/qtquickwidgets-example.png
%%QT_DOCDIR%%/qtquick/images/rect-color.png
%%QT_DOCDIR%%/qtquick/images/rendercontrol-example.jpg
%%QT_DOCDIR%%/qtquick/images/repeater-index.png
%%QT_DOCDIR%%/qtquick/images/repeater-modeldata.png
%%QT_DOCDIR%%/qtquick/images/repeater-simple.png
%%QT_DOCDIR%%/qtquick/images/repeater.png
%%QT_DOCDIR%%/qtquick/images/rowlayout-minimum.png
%%QT_DOCDIR%%/qtquick/images/rowlayout.png
%%QT_DOCDIR%%/qtquick/images/screen-and-window-dimensions.jpg
%%QT_DOCDIR%%/qtquick/images/sg-renderloop-singlethreaded.jpg
%%QT_DOCDIR%%/qtquick/images/sg-renderloop-threaded.jpg
%%QT_DOCDIR%%/qtquick/images/simplematerial-example.jpg
%%QT_DOCDIR%%/qtquick/images/spritecutting.png
%%QT_DOCDIR%%/qtquick/images/spriteenginegraph.png
%%QT_DOCDIR%%/qtquick/images/star.png
%%QT_DOCDIR%%/qtquick/images/textureinsgnode-example.jpg
%%QT_DOCDIR%%/qtquick/images/textureinthread-example.jpg
%%QT_DOCDIR%%/qtquick/images/translate.png
%%QT_DOCDIR%%/qtquick/images/twotextureproviders-example.jpg
%%QT_DOCDIR%%/qtquick/images/verticalpositioner_example.png
%%QT_DOCDIR%%/qtquick/images/verticalpositioner_transition.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-basic.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-delayedbyindex.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-intermediatemove.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-interruptedbad.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-interruptedgood.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-pathanim.gif
%%QT_DOCDIR%%/qtquick/images/viewtransitions-scriptactionbad.gif
%%QT_DOCDIR%%/qtquick/images/visual-coordinates-example.png
%%QT_DOCDIR%%/qtquick/images/visual-parent-example.png
%%QT_DOCDIR%%/qtquick/images/visual-parent-example2.png
%%QT_DOCDIR%%/qtquick/images/visualcanvas_list.png
%%QT_DOCDIR%%/qtquick/images/visualcanvas_overlap.png
%%QT_DOCDIR%%/qtquick/images/visualize-batches.png
%%QT_DOCDIR%%/qtquick/images/visualize-clip.png
%%QT_DOCDIR%%/qtquick/images/visualize-original.png
%%QT_DOCDIR%%/qtquick/images/visualize-overdraw-1.png
%%QT_DOCDIR%%/qtquick/images/visualize-overdraw-2.png
%%QT_DOCDIR%%/qtquick/qml-advtutorial.html
%%QT_DOCDIR%%/qtquick/qml-color.html
%%QT_DOCDIR%%/qtquick/qml-dynamicview-tutorial.html
%%QT_DOCDIR%%/qtquick/qml-font.html
%%QT_DOCDIR%%/qtquick/qml-matrix4x4.html
%%QT_DOCDIR%%/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
%%QT_DOCDIR%%/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
%%QT_DOCDIR%%/qtquick/qml-qt-labs-settings-settings-members.html
%%QT_DOCDIR%%/qtquick/qml-qt-labs-settings-settings.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-accessible-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-accessible.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-anchoranimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-anchoranimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-anchorchanges-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-anchorchanges.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animatedimage-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animatedimage.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animatedsprite-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animatedsprite.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animationcontroller-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animationcontroller.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-animator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-behavior-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-behavior.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-borderimage-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-borderimage.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvas-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvas-obsolete.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvas.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvasgradient-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvasgradient.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvasimagedata-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvasimagedata.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvaspixelarray-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-canvaspixelarray.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-coloranimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-coloranimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-column-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-column.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-context2d-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-context2d.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-doublevalidator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-doublevalidator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-drag-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-drag.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-dragevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-dragevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-droparea-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-droparea.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-enterkey-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-enterkey.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flickable-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flickable.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flipable-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flipable.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flow-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-flow.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-focusscope-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-focusscope.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-fontloader-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-fontloader.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-fontmetrics-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-fontmetrics.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gradient-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gradient.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gradientstop-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gradientstop.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-grid-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-grid.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gridmesh-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gridmesh.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gridview-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-gridview.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-image-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-image.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-intvalidator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-intvalidator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-item-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-item.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-itemgrabresult-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-itemgrabresult.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keyevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keyevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keynavigation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keynavigation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keys-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-keys.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layoutmirroring-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layoutmirroring.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-columnlayout-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-columnlayout.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-gridlayout-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-gridlayout.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-layout-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-layout.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-rowlayout-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-rowlayout.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-stacklayout-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-layouts-stacklayout.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-listview-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-listview.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-loader-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-loader.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-matrix4x4-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-matrix4x4.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-mousearea-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-mousearea.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-mouseevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-mouseevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-multipointtoucharea-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-multipointtoucharea.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-numberanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-numberanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-opacityanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-opacityanimator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-openglinfo-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-openglinfo.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parallelanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parallelanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parentanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parentanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parentchange-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-parentchange.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-affector-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-affector.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-age-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-age.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-angledirection-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-angledirection.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-attractor-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-attractor.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-cumulativedirection-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-cumulativedirection.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-customparticle-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-customparticle.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-direction-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-direction.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-ellipseshape-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-ellipseshape.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-emitter-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-emitter.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-friction-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-friction.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-gravity-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-gravity.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-groupgoal-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-groupgoal.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-imageparticle-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-imageparticle.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-itemparticle-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-itemparticle.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-lineshape-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-lineshape.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-maskshape-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-maskshape.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particle-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particle.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlegroup-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlegroup.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlepainter-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlepainter.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlesystem-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-particlesystem.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-pointdirection-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-pointdirection.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-rectangleshape-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-rectangleshape.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-shape-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-shape.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-spritegoal-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-spritegoal.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-targetdirection-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-targetdirection.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-trailemitter-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-trailemitter.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-turbulence-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-turbulence.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-wander-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-particles-wander.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-path-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-path.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-patharc-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-patharc.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathattribute-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathattribute.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathcubic-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathcubic.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathcurve-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathcurve.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathelement-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathelement.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathinterpolator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathinterpolator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathline-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathline.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathpercent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathpercent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathquad-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathquad.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathsvg-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathsvg.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathview-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pathview.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pauseanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pauseanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pincharea-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pincharea.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pinchevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-pinchevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-positioner-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-positioner.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertyaction-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertyaction.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertyanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertyanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertychanges-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-propertychanges.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rectangle-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rectangle.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-regexpvalidator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-regexpvalidator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-repeater-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-repeater.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotationanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotationanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotationanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-rotationanimator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-row-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-row.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scale-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scale.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scaleanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scaleanimator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scriptaction-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-scriptaction.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-sequentialanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-sequentialanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shadereffect-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shadereffect.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shadereffectsource-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shadereffectsource.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shortcut-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-shortcut.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-smoothedanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-smoothedanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-springanimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-springanimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-sprite-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-sprite.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-spritesequence-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-spritesequence.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-state-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-state.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-statechangescript-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-statechangescript.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-stategroup-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-stategroup.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-systempalette-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-systempalette.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-text-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-text.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textedit-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textedit.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textinput-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textinput.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textmetrics-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-textmetrics.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-touchpoint-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-touchpoint.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-transform-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-transform.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-transition-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-transition.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-translate-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-translate.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-uniformanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-uniformanimator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-vector3danimation-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-vector3danimation.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-viewtransition-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-viewtransition.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-wheelevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-wheelevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-closeevent-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-closeevent.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-screen-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-screen-obsolete.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-screen.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-window-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-window-window.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xanimator.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xmllistmodel-xmllistmodel-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xmllistmodel-xmllistmodel.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xmllistmodel-xmlrole-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-xmllistmodel-xmlrole.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-yanimator-members.html
%%QT_DOCDIR%%/qtquick/qml-qtquick-yanimator.html
%%QT_DOCDIR%%/qtquick/qml-qttest-signalspy-members.html
%%QT_DOCDIR%%/qtquick/qml-qttest-signalspy.html
%%QT_DOCDIR%%/qtquick/qml-qttest-testcase-members.html
%%QT_DOCDIR%%/qtquick/qml-qttest-testcase.html
%%QT_DOCDIR%%/qtquick/qml-quaternion.html
%%QT_DOCDIR%%/qtquick/qml-tutorial.html
%%QT_DOCDIR%%/qtquick/qml-tutorial1.html
%%QT_DOCDIR%%/qtquick/qml-tutorial2.html
%%QT_DOCDIR%%/qtquick/qml-tutorial3.html
%%QT_DOCDIR%%/qtquick/qml-vector2d.html
%%QT_DOCDIR%%/qtquick/qml-vector3d.html
%%QT_DOCDIR%%/qtquick/qml-vector4d.html
%%QT_DOCDIR%%/qtquick/qmlexampletoggleswitch.html
%%QT_DOCDIR%%/qtquick/qquickasyncimageprovider-members.html
%%QT_DOCDIR%%/qtquick/qquickasyncimageprovider.html
%%QT_DOCDIR%%/qtquick/qquickframebufferobject-members.html
%%QT_DOCDIR%%/qtquick/qquickframebufferobject-renderer-members.html
%%QT_DOCDIR%%/qtquick/qquickframebufferobject-renderer.html
%%QT_DOCDIR%%/qtquick/qquickframebufferobject.html
%%QT_DOCDIR%%/qtquick/qquickimageprovider-members.html
%%QT_DOCDIR%%/qtquick/qquickimageprovider.html
%%QT_DOCDIR%%/qtquick/qquickimageresponse-members.html
%%QT_DOCDIR%%/qtquick/qquickimageresponse.html
%%QT_DOCDIR%%/qtquick/qquickitem-itemchangedata-members.html
%%QT_DOCDIR%%/qtquick/qquickitem-itemchangedata.html
%%QT_DOCDIR%%/qtquick/qquickitem-members.html
%%QT_DOCDIR%%/qtquick/qquickitem-updatepaintnodedata-members.html
%%QT_DOCDIR%%/qtquick/qquickitem-updatepaintnodedata.html
%%QT_DOCDIR%%/qtquick/qquickitem.html
%%QT_DOCDIR%%/qtquick/qquickitemgrabresult-members.html
%%QT_DOCDIR%%/qtquick/qquickitemgrabresult.html
%%QT_DOCDIR%%/qtquick/qquickpainteditem-members.html
%%QT_DOCDIR%%/qtquick/qquickpainteditem-obsolete.html
%%QT_DOCDIR%%/qtquick/qquickpainteditem.html
%%QT_DOCDIR%%/qtquick/qquickrendercontrol-members.html
%%QT_DOCDIR%%/qtquick/qquickrendercontrol.html
%%QT_DOCDIR%%/qtquick/qquicktextdocument-members.html
%%QT_DOCDIR%%/qtquick/qquicktextdocument.html
%%QT_DOCDIR%%/qtquick/qquicktexturefactory-members.html
%%QT_DOCDIR%%/qtquick/qquicktexturefactory.html
%%QT_DOCDIR%%/qtquick/qquickview-members.html
%%QT_DOCDIR%%/qtquick/qquickview.html
%%QT_DOCDIR%%/qtquick/qquickwidget-members.html
%%QT_DOCDIR%%/qtquick/qquickwidget.html
%%QT_DOCDIR%%/qtquick/qquickwindow-members.html
%%QT_DOCDIR%%/qtquick/qquickwindow.html
%%QT_DOCDIR%%/qtquick/qsgabstractrenderer-members.html
%%QT_DOCDIR%%/qtquick/qsgabstractrenderer.html
%%QT_DOCDIR%%/qtquick/qsgbasicgeometrynode-members.html
%%QT_DOCDIR%%/qtquick/qsgbasicgeometrynode.html
%%QT_DOCDIR%%/qtquick/qsgclipnode-members.html
%%QT_DOCDIR%%/qtquick/qsgclipnode.html
%%QT_DOCDIR%%/qtquick/qsgdynamictexture-members.html
%%QT_DOCDIR%%/qtquick/qsgdynamictexture.html
%%QT_DOCDIR%%/qtquick/qsgengine-members.html
%%QT_DOCDIR%%/qtquick/qsgengine.html
%%QT_DOCDIR%%/qtquick/qsgflatcolormaterial-members.html
%%QT_DOCDIR%%/qtquick/qsgflatcolormaterial.html
%%QT_DOCDIR%%/qtquick/qsggeometry-attribute-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-attribute.html
%%QT_DOCDIR%%/qtquick/qsggeometry-attributeset-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-attributeset.html
%%QT_DOCDIR%%/qtquick/qsggeometry-coloredpoint2d-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-coloredpoint2d.html
%%QT_DOCDIR%%/qtquick/qsggeometry-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-point2d-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-point2d.html
%%QT_DOCDIR%%/qtquick/qsggeometry-texturedpoint2d-members.html
%%QT_DOCDIR%%/qtquick/qsggeometry-texturedpoint2d.html
%%QT_DOCDIR%%/qtquick/qsggeometry.html
%%QT_DOCDIR%%/qtquick/qsggeometrynode-members.html
%%QT_DOCDIR%%/qtquick/qsggeometrynode.html
%%QT_DOCDIR%%/qtquick/qsgmaterial-members.html
%%QT_DOCDIR%%/qtquick/qsgmaterial.html
%%QT_DOCDIR%%/qtquick/qsgmaterialshader-members.html
%%QT_DOCDIR%%/qtquick/qsgmaterialshader-renderstate-members.html
%%QT_DOCDIR%%/qtquick/qsgmaterialshader-renderstate.html
%%QT_DOCDIR%%/qtquick/qsgmaterialshader.html
%%QT_DOCDIR%%/qtquick/qsgmaterialtype.html
%%QT_DOCDIR%%/qtquick/qsgnode-members.html
%%QT_DOCDIR%%/qtquick/qsgnode.html
%%QT_DOCDIR%%/qtquick/qsgopacitynode-members.html
%%QT_DOCDIR%%/qtquick/qsgopacitynode.html
%%QT_DOCDIR%%/qtquick/qsgopaquetexturematerial-members.html
%%QT_DOCDIR%%/qtquick/qsgopaquetexturematerial.html
%%QT_DOCDIR%%/qtquick/qsgsimplematerial-members.html
%%QT_DOCDIR%%/qtquick/qsgsimplematerial.html
%%QT_DOCDIR%%/qtquick/qsgsimplematerialshader-members.html
%%QT_DOCDIR%%/qtquick/qsgsimplematerialshader.html
%%QT_DOCDIR%%/qtquick/qsgsimplerectnode-members.html
%%QT_DOCDIR%%/qtquick/qsgsimplerectnode.html
%%QT_DOCDIR%%/qtquick/qsgsimpletexturenode-members.html
%%QT_DOCDIR%%/qtquick/qsgsimpletexturenode.html
%%QT_DOCDIR%%/qtquick/qsgtexture-members.html
%%QT_DOCDIR%%/qtquick/qsgtexture.html
%%QT_DOCDIR%%/qtquick/qsgtexturematerial-members.html
%%QT_DOCDIR%%/qtquick/qsgtexturematerial.html
%%QT_DOCDIR%%/qtquick/qsgtextureprovider-members.html
%%QT_DOCDIR%%/qtquick/qsgtextureprovider.html
%%QT_DOCDIR%%/qtquick/qsgtransformnode-members.html
%%QT_DOCDIR%%/qtquick/qsgtransformnode.html
%%QT_DOCDIR%%/qtquick/qsgvertexcolormaterial-members.html
%%QT_DOCDIR%%/qtquick/qsgvertexcolormaterial.html
%%QT_DOCDIR%%/qtquick/qt-labs-folderlistmodel-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qt-labs-settings-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-animation-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-animation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-animation-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-animation-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-basics-animators-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-basics-color-animation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-basics-property-animation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-behaviors-behavior-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-behaviors-siderect-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-behaviors-tvtennis-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-behaviors-wigglytext-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-easing-easing-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-example.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-pathanimation-pathanimation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-pathinterpolator-pathinterpolator-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-states-states-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-animation-states-transitions-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-beziercurve-beziercurve-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-canvas-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-canvas-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-canvas-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-clip-clip-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-example.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-roundedrect-roundedrect-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-smile-smile-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-squircle-squircle-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-tiger-tiger-js.html
%%QT_DOCDIR%%/qtquick/qtquick-canvas-tiger-tiger-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-codesamples.html
%%QT_DOCDIR%%/qtquick/qtquick-convenience-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-cppextensionpoints.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-content-dial-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-content-quitbutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-dialcontrol-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-example.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-dialcontrol-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-flipable-content-card-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-flipable-example.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-flipable-flipable-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-flipable-flipable-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-example.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-painteditem-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-painteditem-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-textballoon-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-textballoon-h.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-textballoonplugin-qmldir.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-painteditem-textballoons-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-scrollbar-example.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-scrollbar-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-scrollbar-scrollbar-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-scrollbar-scrollbar-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-tabwidget-example.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-tabwidget-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-tabwidget-tabwidget-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-customitems-tabwidget-tabwidget-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-calqlatr-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-calqlatr-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-calqlatr-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-calqlatr-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-content-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-content-calculator-js.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-content-display-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-content-numberpad-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-calqlatr-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-clocks-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-clocks-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-clocks-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-clocks-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-content-clock-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-clocks-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-buildbutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-gamecanvas-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-gameoverscreen-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-infobar-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-logic-js.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-mobs-mobbase-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-newgamescreen-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-soundeffect-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-towers-bomb-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-towers-factory-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-towers-melee-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-towers-ranged-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-content-towers-towerbase-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-maroon-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-maroon-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-maroon-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-maroon-maroon-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-photosurface-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-photosurface-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-photosurface-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photosurface-photosurface-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-i18n-qml-de-qm.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-i18n-qml-fr-qm.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewer-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-albumdelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-busyindicator-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-editablebutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-photodelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-progressbar-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-rssmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-script-script-js.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-photoviewercore-tag-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-photoviewer-qml-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-content-busyindicator-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-content-categorydelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-content-newsdelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-content-rssfeeds-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-content-scrollbar-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-rssnews-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-rssnews-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-rssnews-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-rssnews-rssnews-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-bbsettings-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-blackberry-settings-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-block-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-blockemitter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-gamearea-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level0-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level1-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level2-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level3-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level4-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level5-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level6-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level7-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level8-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-level9-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-levels-templatebase-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-logoanimation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-menuemitter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-paintemitter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-primarypack-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-puzzleblock-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-qmldir.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-samegame-js.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-samegametext-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-settings-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-simpleblock-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-content-smoketext-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-samegame-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-samegame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-samegame-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-samegame-samegame-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-checkbox-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-qmldir.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-settings-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stockchart-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stockinfo-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stocklistmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stocklistview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stockmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stocksettingspanel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-stockview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-content-windows-settings-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-stocqt-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-stocqt-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-stocqt-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-stocqt-stocqt-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-flipbar-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-lineinput-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-listfooter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-listheader-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-searchdelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-tweetdelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-tweetsearch-js.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-content-tweetsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-example.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-tweetsearch-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-tweetsearch-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-tweetsearch-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-demos-tweetsearch-tweetsearch-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-draganddrop-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-draganddrop-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-draganddrop-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-draganddrop-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-example.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-tiles-dragtile-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-tiles-droptile-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-tiles-tiles-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-draganddrop-views-gridview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-effects-particles.html
%%QT_DOCDIR%%/qtquick/qtquick-effects-sprites.html
%%QT_DOCDIR%%/qtquick/qtquick-effects-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-effects-transformations.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-draganddroptextitem-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-example.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-externaldraganddrop-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-externaldraganddrop-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-animatedsprite-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-borderimage-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-content-borderimageselector-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-content-imagecell-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-content-myborderimage-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-content-shadowrectangle-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-example.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-image-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-imageelements-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-imageelements-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-imageelements-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-imageelements-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-shadows-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageelements-spritesequence-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-example.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-imageprovider-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-imageprovider-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-imageprovider-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-imageprovider-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-imageprovider-imageprovidercore-qmldir.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-example.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-imageresponseprovider-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-imageresponseprovider-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
%%QT_DOCDIR%%/qtquick/qtquick-index.html
%%QT_DOCDIR%%/qtquick/qtquick-input-focus.html
%%QT_DOCDIR%%/qtquick/qtquick-input-mouseevents.html
%%QT_DOCDIR%%/qtquick/qtquick-input-textinput.html
%%QT_DOCDIR%%/qtquick/qtquick-input-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-example.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-core-contextmenu-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-core-gridmenu-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-core-listmenu-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-core-tabmenu-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-focus-focus-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-keyinteraction-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-keyinteraction-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-keyinteraction-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-keyinteraction-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-keyinteraction-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-example.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-layouts-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-layouts-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-layouts-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-layouts-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-layouts-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-example.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-hello-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-localstorage-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-localstorage-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-localstorage-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-localstorage-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-localstorage-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-localstorage-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-example.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-model-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-model-h.html
%%QT_DOCDIR%%/qtquick/qtquick-models-abstractitemmodel-view-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-dataobject-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-dataobject-h.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-example.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-objectlistmodel-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-objectlistmodel-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-models-objectlistmodel-view-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-models-stringlistmodel-example.html
%%QT_DOCDIR%%/qtquick/qtquick-models-stringlistmodel-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-models-stringlistmodel-stringlistmodel-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-models-stringlistmodel-stringlistmodel-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-models-stringlistmodel-view-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-modelviewsdata-cppmodels.html
%%QT_DOCDIR%%/qtquick/qtquick-modelviewsdata-modelview.html
%%QT_DOCDIR%%/qtquick/qtquick-modelviewsdata-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-module.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-example.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-mousearea-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-mousearea-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-mousearea-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-mousearea-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-mousearea-mousearea-wheel-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-affectors-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-affectors-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-affectors-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-affectors-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-age-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-attractor-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-customaffector-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-friction-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-gravity-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-greybutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-groupgoal-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-move-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-spritegoal-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-turbulence-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-content-wander-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-example.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-affectors-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-content-blurparticles-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-content-fragmentshader-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-content-imagecolors-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-customparticle-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-customparticle-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-customparticle-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-customparticle-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-example.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-customparticle-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-burstandpulse-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-customemitter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-emitmask-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-maximumemitted-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-shapeanddirection-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-trailemitter-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-content-velocityfrommotion-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-emitters-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-emitters-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-emitters-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-emitters-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-example.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-emitters-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-allatonce-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-colored-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-colortable-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-deformation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-rotation-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-sharing-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-content-sprites-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-example.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-imageparticle-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-imageparticle-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-imageparticle-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-imageparticle-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-imageparticle-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-performance.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-content-dynamiccomparison-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-content-dynamicemitters-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-content-multiplepainters-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-content-startstop-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-content-timedgroupchanges-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-example.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-system-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-system-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-system-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-particles-system-system-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-example.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-attachedproperties-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-positioners-positioners-transitions-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-positioning-anchors.html
%%QT_DOCDIR%%/qtquick/qtquick-positioning-layouts.html
%%QT_DOCDIR%%/qtquick/qtquick-positioning-righttoleft.html
%%QT_DOCDIR%%/qtquick/qtquick-positioning-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-accessibility-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-accessibility-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-accessibility-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-content-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-content-checkbox-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-content-slider-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-example.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-quick-accessibility-quick-accessibility-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-quickwidgets-quickwidget-example.html
%%QT_DOCDIR%%/qtquick/qtquick-quickwidgets-quickwidget-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-cuberenderer-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-cuberenderer-h.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-demo-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-example.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-rendercontrol-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-rendercontrol-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-window-multithreaded-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-window-multithreaded-h.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-window-singlethreaded-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-rendercontrol-window-singlethreaded-h.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-example.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-righttoleft-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-righttoleft-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-righttoleft-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-righttoleft-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-textalignment-textalignment-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-righttoleft-textalignment-textalignment-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-beziercurve-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-beziercurve-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-customgeometry-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-customgeometry-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-customgeometry-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-graph-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-graph-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-graph-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-graph-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-gridnode-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-gridnode-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-linenode-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-linenode-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-noisynode-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-graph-noisynode-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-materials.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-nodes.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-squircle-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-openglunderqml-squircle-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-simplematerial-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-simplematerial-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-simplematerial-simplematerial-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-simplematerial-simplematerial-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-simplematerial-simplematerial-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-error-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-textureinthread-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-textureinthread-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-h.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-example.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-main-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-h.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-content-slider-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-example.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-shadereffects-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-shadereffects-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-shadereffects-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-shadereffects-shadereffects-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-statesanimations-animations.html
%%QT_DOCDIR%%/qtquick/qtquick-statesanimations-behaviors.html
%%QT_DOCDIR%%/qtquick/qtquick-statesanimations-states.html
%%QT_DOCDIR%%/qtquick/qtquick-statesanimations-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-text-example.html
%%QT_DOCDIR%%/qtquick/qtquick-text-fonts-availablefonts-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-fonts-banner-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-fonts-fonts-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-fonts-hello-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-imgtag-imgtag-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-imgtag-textwithimage-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-text-styledtext-layout-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-text-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-text-text-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-text-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-text-text-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-text-textselection-textselection-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-text-validator.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-example.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threadedlistmodel-dataloader-js.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threadedlistmodel-example.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threadedlistmodel-timedisplay-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threading-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threading-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threading-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-threading-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-workerscript-spinner-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-workerscript-workerscript-js.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-workerscript-workerscript-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-threading-workerscript-workerscript-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-example.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-flickable-basic-flickable-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-flickable-content-panel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-flickable-corkboards-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-multipointtouch-multiflame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-pincharea-flickresize-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-touchinteraction-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-touchinteraction-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-touchinteraction-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-touchinteraction-touchinteraction-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame1-block-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame1-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame1-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame1-samegame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-block-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-samegame-js.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-samegame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-block-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-dialog-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-samegame-js.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-samegame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-content-button-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-content-samegame-js.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-example.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-samegame-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-views-example.html
%%QT_DOCDIR%%/qtquick/qtquick-views-gridview-gridview-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-petsmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-pressandholdbutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-recipesmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-smalltext-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-textbutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-content-togglebutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-displaymargin-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-dynamiclist-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-expandingdelegates-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-highlight-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-highlightranges-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-listview-sections-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-views-objectmodel-objectmodel-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-package-delegate-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-package-view-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-content-clock-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-content-parallaxview-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-content-pics-home-page-svg.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-content-quitbutton-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-content-smiley-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-parallax-parallax-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-pathview-pathview-example-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-views-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-views-views-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-views-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-views-views-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-views-visualdatamodel-dragselection-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-visualdatamodel-slideshow-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-views-visualdatamodel-visualdatamodel-qmlproject.html
%%QT_DOCDIR%%/qtquick/qtquick-visualcanvas-coordinates.html
%%QT_DOCDIR%%/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
%%QT_DOCDIR%%/qtquick/qtquick-visualcanvas-scenegraph.html
%%QT_DOCDIR%%/qtquick/qtquick-visualcanvas-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-visualcanvas-visualparent.html
%%QT_DOCDIR%%/qtquick/qtquick-visualtypes-topic.html
%%QT_DOCDIR%%/qtquick/qtquick-window-example.html
%%QT_DOCDIR%%/qtquick/qtquick-window-main-cpp.html
%%QT_DOCDIR%%/qtquick/qtquick-window-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick-window-resources-icon-svg.html
%%QT_DOCDIR%%/qtquick/qtquick-window-screeninfo-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-window-splash-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-window-window-pro.html
%%QT_DOCDIR%%/qtquick/qtquick-window-window-qml.html
%%QT_DOCDIR%%/qtquick/qtquick-window-window-qrc.html
%%QT_DOCDIR%%/qtquick/qtquick-xmllistmodel-qmlmodule.html
%%QT_DOCDIR%%/qtquick/qtquick.index
%%QT_DOCDIR%%/qtquick/qtquick.qhp
%%QT_DOCDIR%%/qtquick/qtquick.qhp.sha1
%%QT_DOCDIR%%/qtquick/qtquick.tags
%%QT_DOCDIR%%/qtquick/qtquicklayouts-index.html
%%QT_DOCDIR%%/qtquick/qtquicklayouts-overview.html
%%QT_DOCDIR%%/qtquick/qtquickwidgets-module.html
%%QT_DOCDIR%%/qtquick/qttest-qmlmodule.html
%%QT_DOCDIR%%/qtquick/style/offline-simple.css
%%QT_DOCDIR%%/qtquick/style/offline.css
%%QT_DOCDIR%%/qtquickcontrols.qch
%%QT_DOCDIR%%/qtquickcontrols/applicationwindow.html
%%QT_DOCDIR%%/qtquickcontrols/controls.html
%%QT_DOCDIR%%/qtquickcontrols/controlsstyling.html
%%QT_DOCDIR%%/qtquickcontrols/examples-manifest.xml
%%QT_DOCDIR%%/qtquickcontrols/images/applicationwindow.png
%%QT_DOCDIR%%/qtquickcontrols/images/arrow_bc.png
%%QT_DOCDIR%%/qtquickcontrols/images/bgrContent.png
%%QT_DOCDIR%%/qtquickcontrols/images/btn_next.png
%%QT_DOCDIR%%/qtquickcontrols/images/btn_prev.png
%%QT_DOCDIR%%/qtquickcontrols/images/bullet_dn.png
%%QT_DOCDIR%%/qtquickcontrols/images/bullet_sq.png
%%QT_DOCDIR%%/qtquickcontrols/images/busyindicator.png
%%QT_DOCDIR%%/qtquickcontrols/images/button.png
%%QT_DOCDIR%%/qtquickcontrols/images/calendar.png
%%QT_DOCDIR%%/qtquickcontrols/images/calendarstyle-components-week-numbers.png
%%QT_DOCDIR%%/qtquickcontrols/images/checkbox.png
%%QT_DOCDIR%%/qtquickcontrols/images/circulargauge-angles.png
%%QT_DOCDIR%%/qtquickcontrols/images/circulargauge-needle-example-2.png
%%QT_DOCDIR%%/qtquickcontrols/images/circulargauge-needle.png
%%QT_DOCDIR%%/qtquickcontrols/images/circulargauge-reversed.png
%%QT_DOCDIR%%/qtquickcontrols/images/circulargauge-tickmark-indices-values.png
%%QT_DOCDIR%%/qtquickcontrols/images/combobox.png
%%QT_DOCDIR%%/qtquickcontrols/images/gauge-minorTickmark-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/gauge-temperature.png
%%QT_DOCDIR%%/qtquickcontrols/images/gauge-tickmark-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/groupbox.png
%%QT_DOCDIR%%/qtquickcontrols/images/home.png
%%QT_DOCDIR%%/qtquickcontrols/images/ico_note.png
%%QT_DOCDIR%%/qtquickcontrols/images/ico_note_attention.png
%%QT_DOCDIR%%/qtquickcontrols/images/ico_out.png
%%QT_DOCDIR%%/qtquickcontrols/images/label.png
%%QT_DOCDIR%%/qtquickcontrols/images/logo.png
%%QT_DOCDIR%%/qtquickcontrols/images/menu.png
%%QT_DOCDIR%%/qtquickcontrols/images/menubar-action.png
%%QT_DOCDIR%%/qtquickcontrols/images/menubar.png
%%QT_DOCDIR%%/qtquickcontrols/images/piemenu-menuitem-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/progressbar.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-calendar.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-filesystembrowser.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-gallery-android-dark.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-gallery-android.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-gallery-osx.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-styles.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-tableview.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-text.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-touch.png
%%QT_DOCDIR%%/qtquickcontrols/images/qtquickcontrols-example-uiforms.png
%%QT_DOCDIR%%/qtquickcontrols/images/radiobutton.png
%%QT_DOCDIR%%/qtquickcontrols/images/scrollview.png
%%QT_DOCDIR%%/qtquickcontrols/images/slider.png
%%QT_DOCDIR%%/qtquickcontrols/images/spinbox.png
%%QT_DOCDIR%%/qtquickcontrols/images/splitview.png
%%QT_DOCDIR%%/qtquickcontrols/images/square-blue.png
%%QT_DOCDIR%%/qtquickcontrols/images/square-green.png
%%QT_DOCDIR%%/qtquickcontrols/images/square-red.png
%%QT_DOCDIR%%/qtquickcontrols/images/square-white.png
%%QT_DOCDIR%%/qtquickcontrols/images/square-yellow.png
%%QT_DOCDIR%%/qtquickcontrols/images/stackview.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-background-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-knob-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-minorTickmark-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-needle-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-tickmark-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-circulargauge-tickmarkLabel-example.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-gauge-font-size.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-gauge-foreground.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-gauge-minorTickmark.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-gauge-tickmark.png
%%QT_DOCDIR%%/qtquickcontrols/images/styling-gauge-valueBar.png
%%QT_DOCDIR%%/qtquickcontrols/images/switch.png
%%QT_DOCDIR%%/qtquickcontrols/images/tableview.png
%%QT_DOCDIR%%/qtquickcontrols/images/tabview.png
%%QT_DOCDIR%%/qtquickcontrols/images/textarea.png
%%QT_DOCDIR%%/qtquickcontrols/images/textfield.png
%%QT_DOCDIR%%/qtquickcontrols/images/toolbar.png
%%QT_DOCDIR%%/qtquickcontrols/images/treeview.png
%%QT_DOCDIR%%/qtquickcontrols/images/tumbler-flat-style.png
%%QT_DOCDIR%%/qtquickcontrols/images/tumbler.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/calendar/images/eventindicator.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/bubble.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/button-pressed.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/button.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/progress-background.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/progress-fill.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/slider-handle.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/tab.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/tab_selected.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/styles/images/textfield.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/button_default.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/button_pressed.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/navigation_next_item.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/navigation_previous_item.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/tab_selected.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/tabs_standard.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/textinput.png
%%QT_DOCDIR%%/qtquickcontrols/images/used-in-examples/touch/images/toolbar.png
%%QT_DOCDIR%%/qtquickcontrols/menus.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-action-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-action.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-applicationwindow-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-applicationwindow.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-busyindicator-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-busyindicator.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-button-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-button.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-calendar-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-calendar.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-checkbox-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-checkbox.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-combobox-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-combobox.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-exclusivegroup-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-exclusivegroup.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-groupbox-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-groupbox.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-label-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-label.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menu-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menu.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menubar-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menubar.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menuitem-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menuitem.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menuseparator-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-menuseparator.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-progressbar-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-progressbar.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-radiobutton-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-radiobutton.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-scrollview-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-scrollview.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-slider-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-slider.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-spinbox-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-spinbox.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-splitview-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-splitview.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stack-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stack.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stackview-members.html
@comment %%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stackview-obsolete.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stackview.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stackviewdelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-stackviewdelegate.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-statusbar-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-statusbar.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-applicationwindowstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-busyindicatorstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-buttonstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-calendarstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-checkboxstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-circulargaugestyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-comboboxstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-delaybuttonstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-dialstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-dialstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-gaugestyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-menubarstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-menustyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-menustyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-piemenustyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-progressbarstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-radiobuttonstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-scrollviewstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-sliderstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-spinboxstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-statusbarstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-statusindicatorstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-switchstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-switchstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tableviewstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tabviewstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-textareastyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-textareastyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-textfieldstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-togglebuttonstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-toolbarstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-treeviewstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-styles-tumblerstyle.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-switch-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-switch.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tab-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tab.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tableview-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tableview.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tableviewcolumn-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tableviewcolumn.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tabview-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-tabview.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-textarea-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-textarea.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-textfield-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-textfield.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-toolbar-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-toolbar.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-toolbutton-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-toolbutton.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-treeview-members.html
%%QT_DOCDIR%%/qtquickcontrols/qml-qtquick-controls-treeview.html
%%QT_DOCDIR%%/qtquickcontrols/qtquick-controls-qmlmodule.html
%%QT_DOCDIR%%/qtquickcontrols/qtquick-controls-styles-qmlmodule.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-calendar-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-qml-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-resources-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-src-event-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-src-event-h.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-src-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-calendar-src-sqleventmodel-h.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-examples.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-filesystembrowser-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-filesystembrowser-filesystembrowser-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-filesystembrowser-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-filesystembrowser-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-filesystembrowser-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-gallery-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-gallery-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-android-ui-js.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-buttonpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-inputpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-ios-ui-js.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-osx-ui-js.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-progresspage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-gallery-qml-ui-js.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-index.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-overview.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-platformnotes.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-styles-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-styles-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-styles-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-styles-styles-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-styles-styles-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-src-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-src-sortfilterproxymodel-h.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-tableview-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-tableview-tableview-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-qml-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-qml-toolbarseparator-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-resources-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-src-documenthandler-h.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-src-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-texteditor-texteditor-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-androiddelegate-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-buttonpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-listpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-progressbarpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-sliderpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-tabbarpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-content-textinputpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-resources-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-src-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-touch-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-touch-touch-qmlproject.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-example.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-mainform-ui-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-customermodel-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-history-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-historyform-ui-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-notes-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-notesform-ui-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-settings-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-qml-settingsform-ui-qml.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-uiforms-pro.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols-uiforms-uiforms-qrc.html
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols.index
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols.qhp
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols.qhp.sha1
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrols.tags
%%QT_DOCDIR%%/qtquickcontrols/qtquickcontrolsstyles-index.html
%%QT_DOCDIR%%/qtquickcontrols/style/offline-simple.css
%%QT_DOCDIR%%/qtquickcontrols/style/offline.css
%%QT_DOCDIR%%/qtquickcontrols/styling-circulargauge.html
%%QT_DOCDIR%%/qtquickcontrols/styling-gauge.html
%%QT_DOCDIR%%/qtquickcontrols/stylingtutorials.html
%%QT_DOCDIR%%/qtquickcontrols/views.html
%%QT_DOCDIR%%/qtquickcontrols/viewsstyling.html
%%QT_DOCDIR%%/qtquickcontrols2.qch
%%QT_DOCDIR%%/qtquickcontrols2/examples-manifest.xml
%%QT_DOCDIR%%/qtquickcontrols2/images/arrow_bc.png
%%QT_DOCDIR%%/qtquickcontrols2/images/bgrContent.png
%%QT_DOCDIR%%/qtquickcontrols2/images/btn_next.png
%%QT_DOCDIR%%/qtquickcontrols2/images/btn_prev.png
%%QT_DOCDIR%%/qtquickcontrols2/images/bullet_dn.png
%%QT_DOCDIR%%/qtquickcontrols2/images/bullet_sq.png
%%QT_DOCDIR%%/qtquickcontrols2/images/home.png
%%QT_DOCDIR%%/qtquickcontrols2/images/ico_note.png
%%QT_DOCDIR%%/qtquickcontrols2/images/ico_note_attention.png
%%QT_DOCDIR%%/qtquickcontrols2/images/ico_out.png
%%QT_DOCDIR%%/qtquickcontrols2/images/logo.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-dayofweekrow-layout.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-dayofweekrow.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-monthgrid-layout.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-monthgrid.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-weeknumbercolumn-layout.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtlabscalendar-weeknumbercolumn.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-applicationwindow-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-busyindicator-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-busyindicator.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-busyindicator.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-button-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-button-flat.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-button-highlighted.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-button.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkbox-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkbox-tristate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkbox.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkbox.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkdelegate-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-checkdelegate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-combobox-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-combobox.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-control.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-customize-buttons.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-default.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-dial-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-dial-no-wrap.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-dial-wrap.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-dial.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-drawer-expanded-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-drawer-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-frame-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-frame.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-gallery-drawer.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-gallery-menu.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-gallery-welcome.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-groupbox-checkable.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-groupbox-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-groupbox.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-itemdelegate-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-itemdelegate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-label-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-label.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-material-attributes.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-material-button.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-material-dark.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-material.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-menu.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-page-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-pageindicator-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-pageindicator.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-pane-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-pane.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-popup-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-popup-settings.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-popup-transformorigin.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-progressbar-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-progressbar-disabled.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-progressbar-indeterminate.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-progressbar-normal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton-checked.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton-disabled.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton-focused.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton-normal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiobutton.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiodelegate-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-radiodelegate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-rangeslider-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-rangeslider.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-scrollbar-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-scrollbar.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-scrollindicator-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-scrollindicator.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider-disabled.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider-focused.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider-normal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-slider.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-spinbox-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-spinbox-double.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-spinbox-textual.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-spinbox.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-stackview-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-behind.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-swipedelegate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-swipeview-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch-checked.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch-disabled.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch-focused.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch-normal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switch.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switchdelegate-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-switchdelegate.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tabbar-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tabbar-flickable.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tabbar-wireframe.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tabbutton.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textarea-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textarea-flickable.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textarea.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textfield-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textfield-disabled.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textfield-focused.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textfield-normal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-textfield.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-toolbar-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-toolbar.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-toolbutton-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-toolbutton.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tooltip-slider.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tooltip.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tumbler-custom.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tumbler-wrap.gif
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-tumbler.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-universal-attributes.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-universal-button.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-universal-dark.png
%%QT_DOCDIR%%/qtquickcontrols2/images/qtquickcontrols2-universal.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/back@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/drawer@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/+material/menu@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrow.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrow@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrows.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/arrows@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/back.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/back@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/back@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/back@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/drawer.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/drawer@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/menu.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/menu@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/menu@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/menu@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@2x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@3x.png
%%QT_DOCDIR%%/qtquickcontrols2/images/used-in-examples/gallery/images/qt-logo@4x.png
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-calendar-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-calendar.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-calendarmodel-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-calendarmodel.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-dayofweekrow-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-dayofweekrow.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-monthgrid-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-monthgrid.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-weeknumbercolumn-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qt-labs-calendar2-weeknumbercolumn.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-abstractbutton-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-abstractbutton.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-applicationwindow-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-applicationwindow.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-busyindicator-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-busyindicator.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-button-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-button.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-buttongroup-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-buttongroup.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-checkbox-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-checkbox.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-checkdelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-checkdelegate.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-combobox-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-combobox.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-container-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-container.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-control-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-control.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-dial-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-dial.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-drawer-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-drawer.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-frame-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-frame.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-groupbox-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-groupbox.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-itemdelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-itemdelegate.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-label-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-label.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-menu-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-menu.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-menuitem-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-menuitem.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-page-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-page.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-pageindicator-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-pageindicator.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-pane-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-pane.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-popup-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-popup.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-progressbar-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-progressbar.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-radiobutton-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-radiobutton.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-radiodelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-radiodelegate.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-rangeslider-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-rangeslider.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-scrollbar-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-scrollbar.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-scrollindicator-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-scrollindicator.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-slider-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-slider.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-spinbox-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-spinbox.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-stackview-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-stackview.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-swipedelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-swipedelegate.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-swipeview-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-swipeview.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-switch-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-switch.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-switchdelegate-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-switchdelegate.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tabbar-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tabbar.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tabbutton-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tabbutton.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-textarea-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-textarea.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-textfield-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-textfield.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-toolbar-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-toolbar.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-toolbutton-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-toolbutton.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tooltip-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tooltip.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tumbler-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qml-qtquick-controls2-tumbler.html
%%QT_DOCDIR%%/qtquickcontrols2/qquickstyle-members.html
%%QT_DOCDIR%%/qtquickcontrols2/qquickstyle.html
%%QT_DOCDIR%%/qtquickcontrols2/qt-labs-calendar2-qmlmodule.html
%%QT_DOCDIR%%/qtquickcontrols2/qtlabscalendar-index.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquick-controls2-qmlmodule.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquick-templates2-qmlmodule.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-buttons.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter1-settingup-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-chapter2-lists-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter2-lists-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-contactpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-conversationpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter3-navigation-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-chapter4-models-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-contactpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-conversationpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-h.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-h.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chapter5-styling-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-chattoolbar-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-contactpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-conversationpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-main-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-material-chattoolbar-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-qml-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-h.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-h.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-chattutorial-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-example.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-chattutorial-shared-shared-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-containers.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-customize.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-default.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-delegates.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-deployment.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-differences.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-examples.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-fileselectors.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-example.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-gallery-cpp.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-gallery-pro.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-gallery-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-gallery-qrc.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-busyindicatorpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-buttonpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-checkboxpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-comboboxpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-delegatepage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-dialpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-drawerpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-framepage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-groupboxpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-menupage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-pageindicatorpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-popuppage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-progressbarpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-radiobuttonpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-rangesliderpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollablepage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollbarpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-scrollindicatorpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-sliderpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-spinboxpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-stackviewpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-swipeviewpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-switchpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-tabbarpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-textareapage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-textfieldpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-tooltippage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gallery-pages-tumblerpage-qml.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-gettingstarted.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-guidelines.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-highdpi.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-index.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-indicators.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-input.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-material.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-menus.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-module.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-navigation.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-popups.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-styles.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2-universal.html
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2.index
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2.qhp
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2.qhp.sha1
%%QT_DOCDIR%%/qtquickcontrols2/qtquickcontrols2.tags
%%QT_DOCDIR%%/qtquickcontrols2/qtquicktemplates2-index.html
%%QT_DOCDIR%%/qtquickcontrols2/style/offline-simple.css
%%QT_DOCDIR%%/qtquickcontrols2/style/offline.css
%%QT_DOCDIR%%/qtquickdialogs.qch
%%QT_DOCDIR%%/qtquickdialogs/examples-manifest.xml
%%QT_DOCDIR%%/qtquickdialogs/images/arrow_bc.png
%%QT_DOCDIR%%/qtquickdialogs/images/bgrContent.png
%%QT_DOCDIR%%/qtquickdialogs/images/btn_next.png
%%QT_DOCDIR%%/qtquickdialogs/images/btn_prev.png
%%QT_DOCDIR%%/qtquickdialogs/images/bullet_dn.png
%%QT_DOCDIR%%/qtquickdialogs/images/bullet_sq.png
%%QT_DOCDIR%%/qtquickdialogs/images/critical.png
%%QT_DOCDIR%%/qtquickdialogs/images/home.png
%%QT_DOCDIR%%/qtquickdialogs/images/ico_note.png
%%QT_DOCDIR%%/qtquickdialogs/images/ico_note_attention.png
%%QT_DOCDIR%%/qtquickdialogs/images/ico_out.png
%%QT_DOCDIR%%/qtquickdialogs/images/information.png
%%QT_DOCDIR%%/qtquickdialogs/images/logo.png
%%QT_DOCDIR%%/qtquickdialogs/images/question.png
%%QT_DOCDIR%%/qtquickdialogs/images/replacefile.png
%%QT_DOCDIR%%/qtquickdialogs/images/systemdialogs-example.jpg
%%QT_DOCDIR%%/qtquickdialogs/images/warning.png
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-dialog.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
%%QT_DOCDIR%%/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
%%QT_DOCDIR%%/qtquickdialogs/qtquick-dialogs-qmlmodule.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialog-examples.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-index.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-colordialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-customdialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-example.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-filedialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-fontdialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-main-cpp.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-messagedialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-pro.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qml.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qrc.html
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs.index
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs.qhp
%%QT_DOCDIR%%/qtquickdialogs/qtquickdialogs.qhp.sha1
%%QT_DOCDIR%%/qtquickdialogs/style/offline-simple.css
%%QT_DOCDIR%%/qtquickdialogs/style/offline.css
%%QT_DOCDIR%%/qtquickextras.qch
%%QT_DOCDIR%%/qtquickextras/examples-manifest.xml
%%QT_DOCDIR%%/qtquickextras/images/arrow_bc.png
%%QT_DOCDIR%%/qtquickextras/images/bgrContent.png
%%QT_DOCDIR%%/qtquickextras/images/btn_next.png
%%QT_DOCDIR%%/qtquickextras/images/btn_prev.png
%%QT_DOCDIR%%/qtquickextras/images/bullet_dn.png
%%QT_DOCDIR%%/qtquickextras/images/bullet_sq.png
%%QT_DOCDIR%%/qtquickextras/images/circulargauge.png
%%QT_DOCDIR%%/qtquickextras/images/delaybutton-activated.png
%%QT_DOCDIR%%/qtquickextras/images/delaybutton-progress.png
%%QT_DOCDIR%%/qtquickextras/images/delaybutton.png
%%QT_DOCDIR%%/qtquickextras/images/dial.png
%%QT_DOCDIR%%/qtquickextras/images/gauge.png
%%QT_DOCDIR%%/qtquickextras/images/home.png
%%QT_DOCDIR%%/qtquickextras/images/ico_note.png
%%QT_DOCDIR%%/qtquickextras/images/ico_note_attention.png
%%QT_DOCDIR%%/qtquickextras/images/ico_out.png
%%QT_DOCDIR%%/qtquickextras/images/logo.png
%%QT_DOCDIR%%/qtquickextras/images/piemenu-boundingItem-example.png
%%QT_DOCDIR%%/qtquickextras/images/piemenu-boundingItem-null-example.png
%%QT_DOCDIR%%/qtquickextras/images/piemenu.png
%%QT_DOCDIR%%/qtquickextras/images/qtquickextras-example-dashboard.png
%%QT_DOCDIR%%/qtquickextras/images/qtquickextras-example-flat.png
%%QT_DOCDIR%%/qtquickextras/images/qtquickextras-example-gallery.png
%%QT_DOCDIR%%/qtquickextras/images/statusindicator-active.png
%%QT_DOCDIR%%/qtquickextras/images/statusindicator-green.png
%%QT_DOCDIR%%/qtquickextras/images/statusindicator-inactive.png
%%QT_DOCDIR%%/qtquickextras/images/togglebutton-checked.png
%%QT_DOCDIR%%/qtquickextras/images/togglebutton-unchecked.png
%%QT_DOCDIR%%/qtquickextras/images/tumbler.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/dashboard/images/fuel-icon.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/dashboard/images/temperature-icon.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-normal.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-pressed.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-image-bw.jpg
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-image-rgb.jpg
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-image-sepia.jpg
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-normal.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-pressed.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-normal.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-pressed.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/background-light.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/background.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/center-light.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/center.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/icon-back.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/icon-go.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/icon-settings.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/info.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/needle-light.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/needle.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/qt-logo.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/zoom_in.png
%%QT_DOCDIR%%/qtquickextras/images/used-in-examples/gallery/images/zoom_out.png
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-circulargauge-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-circulargauge.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-delaybutton-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-delaybutton.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-dial-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-dial.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-gauge-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-gauge.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-picture-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-picture.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-piemenu-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-piemenu-obsolete.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-piemenu.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-statusindicator-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-statusindicator-obsolete.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-statusindicator.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-togglebutton-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-togglebutton.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-tumbler-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-tumbler.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-tumblercolumn-members.html
%%QT_DOCDIR%%/qtquickextras/qml-qtquick-extras-tumblercolumn.html
%%QT_DOCDIR%%/qtquickextras/qtquick-extras-qmlmodule.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-dashboard-pro.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-dashboard-qrc.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-example.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-main-cpp.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-dashboard-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-dashboardgaugestyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-icongaugestyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-tachometerstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-turnindicator-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-dashboard-qml-valuesource-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-examples.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-content-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-example.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-flat-pro.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-flat-qrc.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-main-cpp.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-main-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-flat-settingsicon-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-example.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-gallery-pro.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-gallery-qrc.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-main-cpp.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-blackbuttonbackground-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-blackbuttonstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-circulargaugedarkstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-circulargaugedefaultstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-circulargaugelightstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-circulargaugeview-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-controllabel-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-controlview-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-controlviewtoolbar-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-customizerlabel-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-customizerslider-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-customizerswitch-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-flickablemoreindicator-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-gallery-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-piemenucontrolview-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-piemenudarkstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-piemenudefaultstyle-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-gallery-qml-stylepicker-qml.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-index.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras-overview.html
%%QT_DOCDIR%%/qtquickextras/qtquickextras.index
%%QT_DOCDIR%%/qtquickextras/qtquickextras.qhp
%%QT_DOCDIR%%/qtquickextras/qtquickextras.qhp.sha1
%%QT_DOCDIR%%/qtquickextras/style/offline-simple.css
%%QT_DOCDIR%%/qtquickextras/style/offline.css
%%QT_DOCDIR%%/qtscript.qch
%%QT_DOCDIR%%/qtscript/ecmascript.html
%%QT_DOCDIR%%/qtscript/examples-manifest.xml
%%QT_DOCDIR%%/qtscript/images/arrow_bc.png
%%QT_DOCDIR%%/qtscript/images/bgrContent.png
%%QT_DOCDIR%%/qtscript/images/btn_next.png
%%QT_DOCDIR%%/qtscript/images/btn_prev.png
%%QT_DOCDIR%%/qtscript/images/bullet_dn.png
%%QT_DOCDIR%%/qtscript/images/bullet_sq.png
%%QT_DOCDIR%%/qtscript/images/context2d-example-smileysmile.png
%%QT_DOCDIR%%/qtscript/images/context2d-example.png
%%QT_DOCDIR%%/qtscript/images/defaultprototypes-example.png
%%QT_DOCDIR%%/qtscript/images/home.png
%%QT_DOCDIR%%/qtscript/images/ico_note.png
%%QT_DOCDIR%%/qtscript/images/ico_note_attention.png
%%QT_DOCDIR%%/qtscript/images/ico_out.png
%%QT_DOCDIR%%/qtscript/images/logo.png
%%QT_DOCDIR%%/qtscript/images/qtscript-debugger.png
%%QT_DOCDIR%%/qtscript/qscriptable-members.html
%%QT_DOCDIR%%/qtscript/qscriptable.html
%%QT_DOCDIR%%/qtscript/qscriptclass-members.html
%%QT_DOCDIR%%/qtscript/qscriptclass.html
%%QT_DOCDIR%%/qtscript/qscriptclasspropertyiterator-members.html
%%QT_DOCDIR%%/qtscript/qscriptclasspropertyiterator.html
%%QT_DOCDIR%%/qtscript/qscriptcontext-members.html
%%QT_DOCDIR%%/qtscript/qscriptcontext.html
%%QT_DOCDIR%%/qtscript/qscriptcontextinfo-members.html
%%QT_DOCDIR%%/qtscript/qscriptcontextinfo-obsolete.html
%%QT_DOCDIR%%/qtscript/qscriptcontextinfo.html
%%QT_DOCDIR%%/qtscript/qscriptengine-members.html
%%QT_DOCDIR%%/qtscript/qscriptengine-obsolete.html
%%QT_DOCDIR%%/qtscript/qscriptengine.html
%%QT_DOCDIR%%/qtscript/qscriptengineagent-members.html
%%QT_DOCDIR%%/qtscript/qscriptengineagent.html
%%QT_DOCDIR%%/qtscript/qscriptextensionplugin-members.html
%%QT_DOCDIR%%/qtscript/qscriptextensionplugin.html
%%QT_DOCDIR%%/qtscript/qscriptprogram-members.html
%%QT_DOCDIR%%/qtscript/qscriptprogram.html
%%QT_DOCDIR%%/qtscript/qscriptstring-members.html
%%QT_DOCDIR%%/qtscript/qscriptstring.html
%%QT_DOCDIR%%/qtscript/qscriptsyntaxcheckresult-members.html
%%QT_DOCDIR%%/qtscript/qscriptsyntaxcheckresult.html
%%QT_DOCDIR%%/qtscript/qscriptvalue-members.html
%%QT_DOCDIR%%/qtscript/qscriptvalue-obsolete.html
%%QT_DOCDIR%%/qtscript/qscriptvalue.html
%%QT_DOCDIR%%/qtscript/qscriptvalueiterator-members.html
%%QT_DOCDIR%%/qtscript/qscriptvalueiterator.html
%%QT_DOCDIR%%/qtscript/qtscript-index.html
%%QT_DOCDIR%%/qtscript/qtscript-module.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-context2d-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-context2d-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-context2d-pro.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-context2d-qrc.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-domimage-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-domimage-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-environment-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-environment-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-example.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-main-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-qcontext2dcanvas-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-qcontext2dcanvas-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-alpha-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-arc-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-bezier-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-clock-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-fill1-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-grad-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-linecap-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-linestye-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-moveto-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-moveto2-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-pacman-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-plasma-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-pong-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-quad-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-rgba-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-rotate-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-scale-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-stroke1-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-scripts-translate-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-window-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-context2d-window-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-code-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-defaultprototypes-pro.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-defaultprototypes-qrc.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-example.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-main-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-prototypes-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript-script-defaultprototypes-prototypes-h.html
%%QT_DOCDIR%%/qtscript/qtscript-script-helloscript-example.html
%%QT_DOCDIR%%/qtscript/qtscript-script-helloscript-helloscript-js.html
%%QT_DOCDIR%%/qtscript/qtscript-script-helloscript-helloscript-pro.html
%%QT_DOCDIR%%/qtscript/qtscript-script-helloscript-helloscript-qrc.html
%%QT_DOCDIR%%/qtscript/qtscript-script-helloscript-main-cpp.html
%%QT_DOCDIR%%/qtscript/qtscript.index
%%QT_DOCDIR%%/qtscript/qtscript.qhp
%%QT_DOCDIR%%/qtscript/qtscript.qhp.sha1
%%QT_DOCDIR%%/qtscript/qtscriptdebugger-manual.html
%%QT_DOCDIR%%/qtscript/qtscriptextensions.html
%%QT_DOCDIR%%/qtscript/script.html
%%QT_DOCDIR%%/qtscript/style/offline-simple.css
%%QT_DOCDIR%%/qtscript/style/offline.css
%%QT_DOCDIR%%/qtscripttools.qch
%%QT_DOCDIR%%/qtscripttools/images/arrow_bc.png
%%QT_DOCDIR%%/qtscripttools/images/bgrContent.png
%%QT_DOCDIR%%/qtscripttools/images/btn_next.png
%%QT_DOCDIR%%/qtscripttools/images/btn_prev.png
%%QT_DOCDIR%%/qtscripttools/images/bullet_dn.png
%%QT_DOCDIR%%/qtscripttools/images/bullet_sq.png
%%QT_DOCDIR%%/qtscripttools/images/home.png
%%QT_DOCDIR%%/qtscripttools/images/ico_note.png
%%QT_DOCDIR%%/qtscripttools/images/ico_note_attention.png
%%QT_DOCDIR%%/qtscripttools/images/ico_out.png
%%QT_DOCDIR%%/qtscripttools/images/logo.png
%%QT_DOCDIR%%/qtscripttools/qscriptenginedebugger-members.html
%%QT_DOCDIR%%/qtscripttools/qscriptenginedebugger.html
%%QT_DOCDIR%%/qtscripttools/qtscripttools-index.html
%%QT_DOCDIR%%/qtscripttools/qtscripttools-module.html
%%QT_DOCDIR%%/qtscripttools/qtscripttools.index
%%QT_DOCDIR%%/qtscripttools/qtscripttools.qhp
%%QT_DOCDIR%%/qtscripttools/qtscripttools.qhp.sha1
%%QT_DOCDIR%%/qtscripttools/style/offline-simple.css
%%QT_DOCDIR%%/qtscripttools/style/offline.css
%%QT_DOCDIR%%/qtscxml.qch
%%QT_DOCDIR%%/qtscxml/examples-manifest.xml
%%QT_DOCDIR%%/qtscxml/examples-qtscxml.html
%%QT_DOCDIR%%/qtscxml/images/arrow_bc.png
%%QT_DOCDIR%%/qtscxml/images/bgrContent.png
%%QT_DOCDIR%%/qtscxml/images/btn_next.png
%%QT_DOCDIR%%/qtscxml/images/btn_prev.png
%%QT_DOCDIR%%/qtscxml/images/bullet_dn.png
%%QT_DOCDIR%%/qtscxml/images/bullet_sq.png
%%QT_DOCDIR%%/qtscxml/images/calculator-qml.png
%%QT_DOCDIR%%/qtscxml/images/calculator.png
%%QT_DOCDIR%%/qtscxml/images/home.png
%%QT_DOCDIR%%/qtscxml/images/ico_note.png
%%QT_DOCDIR%%/qtscxml/images/ico_note_attention.png
%%QT_DOCDIR%%/qtscxml/images/ico_out.png
%%QT_DOCDIR%%/qtscxml/images/invoke-dynamic.png
%%QT_DOCDIR%%/qtscxml/images/invoke-static.png
%%QT_DOCDIR%%/qtscxml/images/logo.png
%%QT_DOCDIR%%/qtscxml/images/mediaplayer.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-global.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-guicontrol.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-internalstate.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-logicalstate.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-modestate.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-onstate.png
%%QT_DOCDIR%%/qtscxml/images/pinball-statechart-workflow.png
%%QT_DOCDIR%%/qtscxml/images/pinball.png
%%QT_DOCDIR%%/qtscxml/images/trafficlight.png
%%QT_DOCDIR%%/qtscxml/qml-mediaplayer-qml-dynamic-members.html
%%QT_DOCDIR%%/qtscxml/qml-mediaplayer-qml-dynamic.html
%%QT_DOCDIR%%/qtscxml/qml-scxml-statemachineloader-members.html
%%QT_DOCDIR%%/qtscxml/qml-scxml-statemachineloader.html
%%QT_DOCDIR%%/qtscxml/qscxmlc.html
%%QT_DOCDIR%%/qtscxml/qscxmlcppdatamodel-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlcppdatamodel.html
%%QT_DOCDIR%%/qtscxml/qscxmldatamodel-members.html
%%QT_DOCDIR%%/qtscxml/qscxmldatamodel.html
%%QT_DOCDIR%%/qtscxml/qscxmlecmascriptdatamodel-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlecmascriptdatamodel.html
%%QT_DOCDIR%%/qtscxml/qscxmlerror-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlerror.html
%%QT_DOCDIR%%/qtscxml/qscxmlevent-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlevent.html
%%QT_DOCDIR%%/qtscxml/qscxmleventfilter-members.html
%%QT_DOCDIR%%/qtscxml/qscxmleventfilter.html
%%QT_DOCDIR%%/qtscxml/qscxmlnulldatamodel-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlnulldatamodel.html
%%QT_DOCDIR%%/qtscxml/qscxmlparser-loader-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlparser-loader.html
%%QT_DOCDIR%%/qtscxml/qscxmlparser-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlparser.html
%%QT_DOCDIR%%/qtscxml/qscxmlstatemachine-members.html
%%QT_DOCDIR%%/qtscxml/qscxmlstatemachine.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-button-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-calculator-qml-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-calculator-qml-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-calculator-qml-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-calculator-qml-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-qml-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-calculator-widgets-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-calculator-widgets-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-mainwindow-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-mainwindow-h.html
%%QT_DOCDIR%%/qtscxml/qtscxml-calculator-widgets-mainwindow-ui.html
%%QT_DOCDIR%%/qtscxml/qtscxml-index.html
%%QT_DOCDIR%%/qtscxml/qtscxml-instantiating-state-machines.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-dynamic-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-static-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-static-invoke-static-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-static-invoke-static-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-static-invoke-static-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-invoke-static-invoke-static-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-cppdatamodel-scxml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-h.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-dynamic-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-static-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-dynamic-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-static-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-module.html
%%QT_DOCDIR%%/qtscxml/qtscxml-overview.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-main-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-mainwindow-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-mainwindow-h.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-mainwindow-ui.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-pinball-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-pinball-pinball-scxml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-scxml-compliance.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-static-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qml.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-static-example.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-cpp.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-pro.html
%%QT_DOCDIR%%/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-qrc.html
%%QT_DOCDIR%%/qtscxml/qtscxml.index
%%QT_DOCDIR%%/qtscxml/qtscxml.qhp
%%QT_DOCDIR%%/qtscxml/qtscxml.qhp.sha1
%%QT_DOCDIR%%/qtscxml/qtscxml.tags
%%QT_DOCDIR%%/qtscxml/scxml-qmlmodule.html
%%QT_DOCDIR%%/qtscxml/style/offline-simple.css
%%QT_DOCDIR%%/qtscxml/style/offline.css
%%QT_DOCDIR%%/qtsensors.qch
%%QT_DOCDIR%%/qtsensors/compatmap.html
%%QT_DOCDIR%%/qtsensors/creating-a-sensor-plugin.html
%%QT_DOCDIR%%/qtsensors/determining-the-default-sensor-for-a-type.html
%%QT_DOCDIR%%/qtsensors/dynamic-sensor-backend-registration.html
%%QT_DOCDIR%%/qtsensors/examples-manifest.xml
%%QT_DOCDIR%%/qtsensors/genericbackend.html
%%QT_DOCDIR%%/qtsensors/images/accelbubble.png
%%QT_DOCDIR%%/qtsensors/images/arrow_bc.png
%%QT_DOCDIR%%/qtsensors/images/bgrContent.png
%%QT_DOCDIR%%/qtsensors/images/btn_next.png
%%QT_DOCDIR%%/qtsensors/images/btn_prev.png
%%QT_DOCDIR%%/qtsensors/images/bullet_dn.png
%%QT_DOCDIR%%/qtsensors/images/bullet_sq.png
%%QT_DOCDIR%%/qtsensors/images/home.png
%%QT_DOCDIR%%/qtsensors/images/ico_note.png
%%QT_DOCDIR%%/qtsensors/images/ico_note_attention.png
%%QT_DOCDIR%%/qtsensors/images/ico_out.png
%%QT_DOCDIR%%/qtsensors/images/logo.png
%%QT_DOCDIR%%/qtsensors/images/maze.png
%%QT_DOCDIR%%/qtsensors/images/qmlqtsensors.png
%%QT_DOCDIR%%/qtsensors/images/qtsensors-examples-explorer.png
%%QT_DOCDIR%%/qtsensors/images/qtsensors-examples-grue.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-cover.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-doubletap.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-facedown.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-faceup.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-hover.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-shake.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-slam_1.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-slam_2.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-twist.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesture-whip.png
%%QT_DOCDIR%%/qtsensors/images/sensorgesturecpp.png
%%QT_DOCDIR%%/qtsensors/images/sensors-coordinates.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-coordinates2.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-coordinates3.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-dynamic.png
%%QT_DOCDIR%%/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-orientation.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-overview.png
%%QT_DOCDIR%%/qtsensors/images/sensors-rotation-anim.gif
%%QT_DOCDIR%%/qtsensors/images/sensors-rotation.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-rotation2.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-rotation3.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-sides.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-sides2.jpg
%%QT_DOCDIR%%/qtsensors/images/sensors-static.png
%%QT_DOCDIR%%/qtsensors/images/shakeit.png
%%QT_DOCDIR%%/qtsensors/qaccelerometer-members.html
%%QT_DOCDIR%%/qtsensors/qaccelerometer.html
%%QT_DOCDIR%%/qtsensors/qaccelerometerfilter-members.html
%%QT_DOCDIR%%/qtsensors/qaccelerometerfilter.html
%%QT_DOCDIR%%/qtsensors/qaccelerometerreading-members.html
%%QT_DOCDIR%%/qtsensors/qaccelerometerreading.html
%%QT_DOCDIR%%/qtsensors/qaltimeter-members.html
%%QT_DOCDIR%%/qtsensors/qaltimeter.html
%%QT_DOCDIR%%/qtsensors/qaltimeterfilter-members.html
%%QT_DOCDIR%%/qtsensors/qaltimeterfilter.html
%%QT_DOCDIR%%/qtsensors/qaltimeterreading-members.html
%%QT_DOCDIR%%/qtsensors/qaltimeterreading.html
%%QT_DOCDIR%%/qtsensors/qambientlightfilter-members.html
%%QT_DOCDIR%%/qtsensors/qambientlightfilter.html
%%QT_DOCDIR%%/qtsensors/qambientlightreading-members.html
%%QT_DOCDIR%%/qtsensors/qambientlightreading.html
%%QT_DOCDIR%%/qtsensors/qambientlightsensor-members.html
%%QT_DOCDIR%%/qtsensors/qambientlightsensor.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturefilter-members.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturefilter.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturereading-members.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturereading.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturesensor-members.html
%%QT_DOCDIR%%/qtsensors/qambienttemperaturesensor.html
%%QT_DOCDIR%%/qtsensors/qcompass-members.html
%%QT_DOCDIR%%/qtsensors/qcompass.html
%%QT_DOCDIR%%/qtsensors/qcompassfilter-members.html
%%QT_DOCDIR%%/qtsensors/qcompassfilter.html
%%QT_DOCDIR%%/qtsensors/qcompassreading-members.html
%%QT_DOCDIR%%/qtsensors/qcompassreading.html
%%QT_DOCDIR%%/qtsensors/qdistancefilter-members.html
%%QT_DOCDIR%%/qtsensors/qdistancefilter.html
%%QT_DOCDIR%%/qtsensors/qdistancereading-members.html
%%QT_DOCDIR%%/qtsensors/qdistancereading.html
%%QT_DOCDIR%%/qtsensors/qdistancesensor-members.html
%%QT_DOCDIR%%/qtsensors/qdistancesensor.html
%%QT_DOCDIR%%/qtsensors/qgyroscope-members.html
%%QT_DOCDIR%%/qtsensors/qgyroscope.html
%%QT_DOCDIR%%/qtsensors/qgyroscopefilter-members.html
%%QT_DOCDIR%%/qtsensors/qgyroscopefilter.html
%%QT_DOCDIR%%/qtsensors/qgyroscopereading-members.html
%%QT_DOCDIR%%/qtsensors/qgyroscopereading.html
%%QT_DOCDIR%%/qtsensors/qholsterfilter-members.html
%%QT_DOCDIR%%/qtsensors/qholsterfilter.html
%%QT_DOCDIR%%/qtsensors/qholsterreading-members.html
%%QT_DOCDIR%%/qtsensors/qholsterreading.html
%%QT_DOCDIR%%/qtsensors/qholstersensor-members.html
%%QT_DOCDIR%%/qtsensors/qholstersensor.html
%%QT_DOCDIR%%/qtsensors/qirproximityfilter-members.html
%%QT_DOCDIR%%/qtsensors/qirproximityfilter.html
%%QT_DOCDIR%%/qtsensors/qirproximityreading-members.html
%%QT_DOCDIR%%/qtsensors/qirproximityreading.html
%%QT_DOCDIR%%/qtsensors/qirproximitysensor-members.html
%%QT_DOCDIR%%/qtsensors/qirproximitysensor.html
%%QT_DOCDIR%%/qtsensors/qlightfilter-members.html
%%QT_DOCDIR%%/qtsensors/qlightfilter.html
%%QT_DOCDIR%%/qtsensors/qlightreading-members.html
%%QT_DOCDIR%%/qtsensors/qlightreading.html
%%QT_DOCDIR%%/qtsensors/qlightsensor-members.html
%%QT_DOCDIR%%/qtsensors/qlightsensor.html
%%QT_DOCDIR%%/qtsensors/qmagnetometer-members.html
%%QT_DOCDIR%%/qtsensors/qmagnetometer.html
%%QT_DOCDIR%%/qtsensors/qmagnetometerfilter-members.html
%%QT_DOCDIR%%/qtsensors/qmagnetometerfilter.html
%%QT_DOCDIR%%/qtsensors/qmagnetometerreading-members.html
%%QT_DOCDIR%%/qtsensors/qmagnetometerreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-accelerometer-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-accelerometer.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-accelerometerreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-accelerometerreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-altimeter-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-altimeter.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-altimeterreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-altimeterreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambientlightreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambientlightreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambientlightsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambientlightsensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambienttemperaturereading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-compass-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-compass.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-compassreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-compassreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-distancereading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-distancereading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-distancesensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-distancesensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-gyroscope-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-gyroscope.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-gyroscopereading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-gyroscopereading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-holsterreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-holsterreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-holstersensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-holstersensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-irproximityreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-irproximityreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-irproximitysensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-irproximitysensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-lightreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-lightreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-lightsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-lightsensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-magnetometer-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-magnetometer.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-magnetometerreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-magnetometerreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-orientationreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-orientationreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-orientationsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-orientationsensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-pressurereading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-pressurereading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-pressuresensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-pressuresensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-proximityreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-proximityreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-proximitysensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-proximitysensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-rotationreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-rotationreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-rotationsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-rotationsensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorgesture-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorgesture.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorglobal-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorglobal.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-sensorreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tapreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tapreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tapsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tapsensor.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tiltreading-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tiltreading.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tiltsensor-members.html
%%QT_DOCDIR%%/qtsensors/qml-qtsensors-tiltsensor.html
%%QT_DOCDIR%%/qtsensors/qorientationfilter-members.html
%%QT_DOCDIR%%/qtsensors/qorientationfilter.html
%%QT_DOCDIR%%/qtsensors/qorientationreading-members.html
%%QT_DOCDIR%%/qtsensors/qorientationreading.html
%%QT_DOCDIR%%/qtsensors/qorientationsensor-members.html
%%QT_DOCDIR%%/qtsensors/qorientationsensor.html
%%QT_DOCDIR%%/qtsensors/qpressurefilter-members.html
%%QT_DOCDIR%%/qtsensors/qpressurefilter.html
%%QT_DOCDIR%%/qtsensors/qpressurereading-members.html
%%QT_DOCDIR%%/qtsensors/qpressurereading.html
%%QT_DOCDIR%%/qtsensors/qpressuresensor-members.html
%%QT_DOCDIR%%/qtsensors/qpressuresensor.html
%%QT_DOCDIR%%/qtsensors/qproximityfilter-members.html
%%QT_DOCDIR%%/qtsensors/qproximityfilter.html
%%QT_DOCDIR%%/qtsensors/qproximityreading-members.html
%%QT_DOCDIR%%/qtsensors/qproximityreading.html
%%QT_DOCDIR%%/qtsensors/qproximitysensor-members.html
%%QT_DOCDIR%%/qtsensors/qproximitysensor.html
%%QT_DOCDIR%%/qtsensors/qrotationfilter-members.html
%%QT_DOCDIR%%/qtsensors/qrotationfilter.html
%%QT_DOCDIR%%/qtsensors/qrotationreading-members.html
%%QT_DOCDIR%%/qtsensors/qrotationreading.html
%%QT_DOCDIR%%/qtsensors/qrotationsensor-members.html
%%QT_DOCDIR%%/qtsensors/qrotationsensor.html
%%QT_DOCDIR%%/qtsensors/qsensor-members.html
%%QT_DOCDIR%%/qtsensors/qsensor.html
%%QT_DOCDIR%%/qtsensors/qsensorbackend-members.html
%%QT_DOCDIR%%/qtsensors/qsensorbackend.html
%%QT_DOCDIR%%/qtsensors/qsensorbackendfactory-members.html
%%QT_DOCDIR%%/qtsensors/qsensorbackendfactory.html
%%QT_DOCDIR%%/qtsensors/qsensorchangesinterface-members.html
%%QT_DOCDIR%%/qtsensors/qsensorchangesinterface.html
%%QT_DOCDIR%%/qtsensors/qsensorfilter-members.html
%%QT_DOCDIR%%/qtsensors/qsensorfilter.html
%%QT_DOCDIR%%/qtsensors/qsensorgesture-members.html
%%QT_DOCDIR%%/qtsensors/qsensorgesture.html
%%QT_DOCDIR%%/qtsensors/qsensorgesturemanager-members.html
%%QT_DOCDIR%%/qtsensors/qsensorgesturemanager.html
%%QT_DOCDIR%%/qtsensors/qsensorgestureplugininterface-members.html
%%QT_DOCDIR%%/qtsensors/qsensorgestureplugininterface.html
%%QT_DOCDIR%%/qtsensors/qsensorgesturerecognizer-members.html
%%QT_DOCDIR%%/qtsensors/qsensorgesturerecognizer.html
%%QT_DOCDIR%%/qtsensors/qsensormanager-members.html
%%QT_DOCDIR%%/qtsensors/qsensormanager.html
%%QT_DOCDIR%%/qtsensors/qsensorplugininterface-members.html
%%QT_DOCDIR%%/qtsensors/qsensorplugininterface.html
%%QT_DOCDIR%%/qtsensors/qsensorreading-members.html
%%QT_DOCDIR%%/qtsensors/qsensorreading.html
%%QT_DOCDIR%%/qtsensors/qtapfilter-members.html
%%QT_DOCDIR%%/qtsensors/qtapfilter.html
%%QT_DOCDIR%%/qtsensors/qtapreading-members.html
%%QT_DOCDIR%%/qtsensors/qtapreading.html
%%QT_DOCDIR%%/qtsensors/qtapsensor-members.html
%%QT_DOCDIR%%/qtsensors/qtapsensor.html
%%QT_DOCDIR%%/qtsensors/qtiltfilter-members.html
%%QT_DOCDIR%%/qtsensors/qtiltfilter.html
%%QT_DOCDIR%%/qtsensors/qtiltreading-members.html
%%QT_DOCDIR%%/qtsensors/qtiltreading.html
%%QT_DOCDIR%%/qtsensors/qtiltsensor-members.html
%%QT_DOCDIR%%/qtsensors/qtiltsensor.html
%%QT_DOCDIR%%/qtsensors/qtsensorgestures-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-accelbubble-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-accelbubble-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-accelbubble-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-content-bluebubble-svg.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-accelbubble-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-examples.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-console-app-console-app-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-grue-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-grue-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-import-import-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-import-qmldir.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-lib-gruesensor-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-lib-gruesensor-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-lib-gruesensor-p-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-lib-lib-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-plugin-gruesensorimpl-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-plugin-gruesensorimpl-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-plugin-plugin-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-qml-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-grue-qml-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-index.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-android-androidmanifest-xml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-components-applicationwindow-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-components-button-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-congratulation-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-labyrinthsquare-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-lib-js.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-maze-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-maze-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-maze-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-maze-mouse-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-module.html
%%QT_DOCDIR%%/qtsensors/qtsensors-porting.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlmodule.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-components-applicationwindow-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-components-button-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-components-divider-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-button-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-gesturelist-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-gesturesview-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-gestureview-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-plugin-plugin-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-qml-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-qml-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-explorer-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-explorer-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-import-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-qmldir.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-sensoritem-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-import-sensoritem-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-qml-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-qml-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-sensor-explorer-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensor-explorer-sensor-explorer-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-mainwindow-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-mainwindow-h.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-mainwindow-ui.html
%%QT_DOCDIR%%/qtsensors/qtsensors-sensorgestures-sensorgestures-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-shakeit-example.html
%%QT_DOCDIR%%/qtsensors/qtsensors-shakeit-main-cpp.html
%%QT_DOCDIR%%/qtsensors/qtsensors-shakeit-shakeit-pro.html
%%QT_DOCDIR%%/qtsensors/qtsensors-shakeit-shakeit-qml.html
%%QT_DOCDIR%%/qtsensors/qtsensors-shakeit-shakeit-qrc.html
%%QT_DOCDIR%%/qtsensors/qtsensors.index
%%QT_DOCDIR%%/qtsensors/qtsensors.qhp
%%QT_DOCDIR%%/qtsensors/qtsensors.qhp.sha1
%%QT_DOCDIR%%/qtsensors/qtsensors.tags
%%QT_DOCDIR%%/qtsensors/senorfwbackend.html
%%QT_DOCDIR%%/qtsensors/sensorgesture-emulator-topics.html
%%QT_DOCDIR%%/qtsensors/sensorgesture-plugins-topics.html
%%QT_DOCDIR%%/qtsensors/sensors-backend-topics.html
%%QT_DOCDIR%%/qtsensors/style/offline-simple.css
%%QT_DOCDIR%%/qtsensors/style/offline.css
%%QT_DOCDIR%%/qtserialbus.qch
%%QT_DOCDIR%%/qtserialbus/examples-manifest.xml
%%QT_DOCDIR%%/qtserialbus/images/arrow_bc.png
%%QT_DOCDIR%%/qtserialbus/images/bgrContent.png
%%QT_DOCDIR%%/qtserialbus/images/btn_next.png
%%QT_DOCDIR%%/qtserialbus/images/btn_prev.png
%%QT_DOCDIR%%/qtserialbus/images/bullet_dn.png
%%QT_DOCDIR%%/qtserialbus/images/bullet_sq.png
%%QT_DOCDIR%%/qtserialbus/images/can-example.png
%%QT_DOCDIR%%/qtserialbus/images/home.png
%%QT_DOCDIR%%/qtserialbus/images/ico_note.png
%%QT_DOCDIR%%/qtserialbus/images/ico_note_attention.png
%%QT_DOCDIR%%/qtserialbus/images/ico_out.png
%%QT_DOCDIR%%/qtserialbus/images/logo.png
%%QT_DOCDIR%%/qtserialbus/images/modbusmaster.png
%%QT_DOCDIR%%/qtserialbus/images/modbusserver.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/can/images/application-exit.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/can/images/clear.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/can/images/connect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/can/images/disconnect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/master/images/application-exit.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/master/images/connect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/master/images/disconnect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/master/images/settings.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/slave/images/application-exit.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/slave/images/connect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/slave/images/disconnect.png
%%QT_DOCDIR%%/qtserialbus/images/used-in-examples/modbus/slave/images/settings.png
%%QT_DOCDIR%%/qtserialbus/qcanbus-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbus.html
%%QT_DOCDIR%%/qtserialbus/qcanbusdevice-filter-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbusdevice-filter.html
%%QT_DOCDIR%%/qtserialbus/qcanbusdevice-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbusdevice.html
%%QT_DOCDIR%%/qtserialbus/qcanbusfactory-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbusfactory.html
%%QT_DOCDIR%%/qtserialbus/qcanbusframe-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbusframe-timestamp-members.html
%%QT_DOCDIR%%/qtserialbus/qcanbusframe-timestamp.html
%%QT_DOCDIR%%/qtserialbus/qcanbusframe.html
%%QT_DOCDIR%%/qtserialbus/qmodbusclient-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusclient.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdataunit-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdataunit.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdevice-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdevice.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdeviceidentification-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusdeviceidentification.html
%%QT_DOCDIR%%/qtserialbus/qmodbusexceptionresponse-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusexceptionresponse.html
%%QT_DOCDIR%%/qtserialbus/qmodbuspdu-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbuspdu.html
%%QT_DOCDIR%%/qtserialbus/qmodbusreply-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusreply.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrequest-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrequest.html
%%QT_DOCDIR%%/qtserialbus/qmodbusresponse-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusresponse.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrtuserialmaster-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrtuserialmaster.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrtuserialslave-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusrtuserialslave.html
%%QT_DOCDIR%%/qtserialbus/qmodbusserver-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbusserver.html
%%QT_DOCDIR%%/qtserialbus/qmodbustcpclient-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbustcpclient.html
%%QT_DOCDIR%%/qtserialbus/qmodbustcpserver-members.html
%%QT_DOCDIR%%/qtserialbus/qmodbustcpserver.html
%%QT_DOCDIR%%/qtserialbus/qtcanbus-backends.html
%%QT_DOCDIR%%/qtserialbus/qtmodbus-backends.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-can-pro.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-can-qrc.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-connectdialog-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-connectdialog-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-connectdialog-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-example.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-main-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-mainwindow-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-mainwindow-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-can-mainwindow-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-examples.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-index.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-example.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-main-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-mainwindow-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-mainwindow-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-mainwindow-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-master-pro.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-master-qrc.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-settingsdialog-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-settingsdialog-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-settingsdialog-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-writeregistermodel-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-master-writeregistermodel-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-example.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-main-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-mainwindow-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-mainwindow-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-mainwindow-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-settingsdialog-cpp.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-settingsdialog-h.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-settingsdialog-ui.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-slave-pro.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-modbus-slave-slave-qrc.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-module.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-peakcan-overview.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-socketcan-overview.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus-tinycan-overview.html
%%QT_DOCDIR%%/qtserialbus/qtserialbus.index
%%QT_DOCDIR%%/qtserialbus/qtserialbus.qhp
%%QT_DOCDIR%%/qtserialbus/qtserialbus.qhp.sha1
%%QT_DOCDIR%%/qtserialbus/qtserialbus.tags
%%QT_DOCDIR%%/qtserialbus/style/offline-simple.css
%%QT_DOCDIR%%/qtserialbus/style/offline.css
%%QT_DOCDIR%%/qtserialport.qch
%%QT_DOCDIR%%/qtserialport/examples-manifest.xml
%%QT_DOCDIR%%/qtserialport/images/arrow_bc.png
%%QT_DOCDIR%%/qtserialport/images/bgrContent.png
%%QT_DOCDIR%%/qtserialport/images/blockingmaster-example.png
%%QT_DOCDIR%%/qtserialport/images/blockingslave-example.png
%%QT_DOCDIR%%/qtserialport/images/btn_next.png
%%QT_DOCDIR%%/qtserialport/images/btn_prev.png
%%QT_DOCDIR%%/qtserialport/images/bullet_dn.png
%%QT_DOCDIR%%/qtserialport/images/bullet_sq.png
%%QT_DOCDIR%%/qtserialport/images/cenumerator-example.png
%%QT_DOCDIR%%/qtserialport/images/creaderasync-example.png
%%QT_DOCDIR%%/qtserialport/images/creadersync-example.png
%%QT_DOCDIR%%/qtserialport/images/cwriterasync-example.png
%%QT_DOCDIR%%/qtserialport/images/cwritersync-example.png
%%QT_DOCDIR%%/qtserialport/images/enumerator-example.png
%%QT_DOCDIR%%/qtserialport/images/home.png
%%QT_DOCDIR%%/qtserialport/images/ico_note.png
%%QT_DOCDIR%%/qtserialport/images/ico_note_attention.png
%%QT_DOCDIR%%/qtserialport/images/ico_out.png
%%QT_DOCDIR%%/qtserialport/images/logo.png
%%QT_DOCDIR%%/qtserialport/images/terminal-example.png
%%QT_DOCDIR%%/qtserialport/images/used-in-examples/terminal/images/application-exit.png
%%QT_DOCDIR%%/qtserialport/images/used-in-examples/terminal/images/clear.png
%%QT_DOCDIR%%/qtserialport/images/used-in-examples/terminal/images/connect.png
%%QT_DOCDIR%%/qtserialport/images/used-in-examples/terminal/images/disconnect.png
%%QT_DOCDIR%%/qtserialport/images/used-in-examples/terminal/images/settings.png
%%QT_DOCDIR%%/qtserialport/qserialport-members.html
%%QT_DOCDIR%%/qtserialport/qserialport-obsolete.html
%%QT_DOCDIR%%/qtserialport/qserialport.html
%%QT_DOCDIR%%/qtserialport/qserialportinfo-members.html
%%QT_DOCDIR%%/qtserialport/qserialportinfo-obsolete.html
%%QT_DOCDIR%%/qtserialport/qserialportinfo.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-blockingmaster-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-dialog-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-dialog-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-masterthread-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingmaster-masterthread-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-blockingslave-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-dialog-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-dialog-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-slavethread-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-blockingslave-slavethread-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cenumerator-cenumerator-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cenumerator-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cenumerator-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creaderasync-creaderasync-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creaderasync-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creaderasync-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creaderasync-serialportreader-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creaderasync-serialportreader-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creadersync-creadersync-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creadersync-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-creadersync-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwriterasync-cwriterasync-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwriterasync-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwriterasync-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwriterasync-serialportwriter-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwriterasync-serialportwriter-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwritersync-cwritersync-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwritersync-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-cwritersync-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-enumerator-enumerator-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-enumerator-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-enumerator-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-examples.html
%%QT_DOCDIR%%/qtserialport/qtserialport-index.html
%%QT_DOCDIR%%/qtserialport/qtserialport-module.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-console-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-console-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-example.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-main-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-mainwindow-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-mainwindow-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-mainwindow-ui.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-settingsdialog-cpp.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-settingsdialog-h.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-settingsdialog-ui.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-terminal-pro.html
%%QT_DOCDIR%%/qtserialport/qtserialport-terminal-terminal-qrc.html
%%QT_DOCDIR%%/qtserialport/qtserialport.index
%%QT_DOCDIR%%/qtserialport/qtserialport.qhp
%%QT_DOCDIR%%/qtserialport/qtserialport.qhp.sha1
%%QT_DOCDIR%%/qtserialport/style/offline-simple.css
%%QT_DOCDIR%%/qtserialport/style/offline.css
%%QT_DOCDIR%%/qtsql.qch
%%QT_DOCDIR%%/qtsql/database.html
%%QT_DOCDIR%%/qtsql/examples-manifest.xml
%%QT_DOCDIR%%/qtsql/images/arrow_bc.png
%%QT_DOCDIR%%/qtsql/images/bgrContent.png
%%QT_DOCDIR%%/qtsql/images/books-demo.png
%%QT_DOCDIR%%/qtsql/images/btn_next.png
%%QT_DOCDIR%%/qtsql/images/btn_prev.png
%%QT_DOCDIR%%/qtsql/images/bullet_dn.png
%%QT_DOCDIR%%/qtsql/images/bullet_sq.png
%%QT_DOCDIR%%/qtsql/images/cachedtable-example.png
%%QT_DOCDIR%%/qtsql/images/drilldown-example.png
%%QT_DOCDIR%%/qtsql/images/foreignkeys.png
%%QT_DOCDIR%%/qtsql/images/home.png
%%QT_DOCDIR%%/qtsql/images/ico_note.png
%%QT_DOCDIR%%/qtsql/images/ico_note_attention.png
%%QT_DOCDIR%%/qtsql/images/ico_out.png
%%QT_DOCDIR%%/qtsql/images/insertrowinmodelview.png
%%QT_DOCDIR%%/qtsql/images/logo.png
%%QT_DOCDIR%%/qtsql/images/masterdetail-example.png
%%QT_DOCDIR%%/qtsql/images/noforeignkeys.png
%%QT_DOCDIR%%/qtsql/images/qdatawidgetmapper-simple.png
%%QT_DOCDIR%%/qtsql/images/querymodel-example.png
%%QT_DOCDIR%%/qtsql/images/relationaltable.png
%%QT_DOCDIR%%/qtsql/images/relationaltablemodel-example.png
%%QT_DOCDIR%%/qtsql/images/sql-widget-mapper.png
%%QT_DOCDIR%%/qtsql/images/sqlbrowser-demo.png
%%QT_DOCDIR%%/qtsql/images/tablemodel-example.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/books/images/star.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/drilldown/images/qt-creator.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/drilldown/images/qt-logo.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/drilldown/images/qt-project.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/drilldown/images/qt-quick.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/masterdetail/images/icon.png
%%QT_DOCDIR%%/qtsql/images/used-in-examples/masterdetail/images/image.png
%%QT_DOCDIR%%/qtsql/images/widgetmapper-sql-mapping-table.png
%%QT_DOCDIR%%/qtsql/images/widgetmapper-sql-mapping.png
%%QT_DOCDIR%%/qtsql/qsql.html
%%QT_DOCDIR%%/qtsql/qsqldatabase-members.html
%%QT_DOCDIR%%/qtsql/qsqldatabase.html
%%QT_DOCDIR%%/qtsql/qsqldriver-members.html
%%QT_DOCDIR%%/qtsql/qsqldriver.html
%%QT_DOCDIR%%/qtsql/qsqldrivercreator-members.html
%%QT_DOCDIR%%/qtsql/qsqldrivercreator.html
%%QT_DOCDIR%%/qtsql/qsqldrivercreatorbase-members.html
%%QT_DOCDIR%%/qtsql/qsqldrivercreatorbase.html
%%QT_DOCDIR%%/qtsql/qsqldriverplugin-members.html
%%QT_DOCDIR%%/qtsql/qsqldriverplugin.html
%%QT_DOCDIR%%/qtsql/qsqlerror-members.html
%%QT_DOCDIR%%/qtsql/qsqlerror-obsolete.html
%%QT_DOCDIR%%/qtsql/qsqlerror.html
%%QT_DOCDIR%%/qtsql/qsqlfield-members.html
%%QT_DOCDIR%%/qtsql/qsqlfield.html
%%QT_DOCDIR%%/qtsql/qsqlindex-members.html
%%QT_DOCDIR%%/qtsql/qsqlindex.html
%%QT_DOCDIR%%/qtsql/qsqlquery-members.html
%%QT_DOCDIR%%/qtsql/qsqlquery.html
%%QT_DOCDIR%%/qtsql/qsqlquerymodel-members.html
%%QT_DOCDIR%%/qtsql/qsqlquerymodel.html
%%QT_DOCDIR%%/qtsql/qsqlrecord-members.html
%%QT_DOCDIR%%/qtsql/qsqlrecord.html
%%QT_DOCDIR%%/qtsql/qsqlrelation-members.html
%%QT_DOCDIR%%/qtsql/qsqlrelation.html
%%QT_DOCDIR%%/qtsql/qsqlrelationaldelegate-members.html
%%QT_DOCDIR%%/qtsql/qsqlrelationaldelegate.html
%%QT_DOCDIR%%/qtsql/qsqlrelationaltablemodel-members.html
%%QT_DOCDIR%%/qtsql/qsqlrelationaltablemodel.html
%%QT_DOCDIR%%/qtsql/qsqlresult-members.html
%%QT_DOCDIR%%/qtsql/qsqlresult.html
%%QT_DOCDIR%%/qtsql/qsqltablemodel-members.html
%%QT_DOCDIR%%/qtsql/qsqltablemodel.html
%%QT_DOCDIR%%/qtsql/qtsql-books-bookdelegate-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-books-bookdelegate-h.html
%%QT_DOCDIR%%/qtsql/qtsql-books-books-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-books-books-qrc.html
%%QT_DOCDIR%%/qtsql/qtsql-books-bookwindow-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-books-bookwindow-h.html
%%QT_DOCDIR%%/qtsql/qtsql-books-bookwindow-ui.html
%%QT_DOCDIR%%/qtsql/qtsql-books-example.html
%%QT_DOCDIR%%/qtsql/qtsql-books-initdb-h.html
%%QT_DOCDIR%%/qtsql/qtsql-books-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-cachedtable-cachedtable-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-cachedtable-example.html
%%QT_DOCDIR%%/qtsql/qtsql-cachedtable-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-cachedtable-tableeditor-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-cachedtable-tableeditor-h.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-drilldown-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-drilldown-qrc.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-example.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-imageitem-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-imageitem-h.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-informationwindow-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-informationwindow-h.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-view-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-drilldown-view-h.html
%%QT_DOCDIR%%/qtsql/qtsql-index.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-albumdetails-xml.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-database-h.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-dialog-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-dialog-h.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-example.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-mainwindow-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-mainwindow-h.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-masterdetail-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-masterdetail-masterdetail-qrc.html
%%QT_DOCDIR%%/qtsql/qtsql-module.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-customsqlmodel-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-customsqlmodel-h.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-editablesqlmodel-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-editablesqlmodel-h.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-example.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-querymodel-querymodel-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-relationaltablemodel-example.html
%%QT_DOCDIR%%/qtsql/qtsql-relationaltablemodel-relationaltablemodel-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-relationaltablemodel-relationaltablemodel-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-browser-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-browser-h.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-browserwidget-ui.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-connectionwidget-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-connectionwidget-h.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-example.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-h.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-ui.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlbrowser-sqlbrowser-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlwidgetmapper-example.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlwidgetmapper-main-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlwidgetmapper-sqlwidgetmapper-pro.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlwidgetmapper-window-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-sqlwidgetmapper-window-h.html
%%QT_DOCDIR%%/qtsql/qtsql-tablemodel-example.html
%%QT_DOCDIR%%/qtsql/qtsql-tablemodel-tablemodel-cpp.html
%%QT_DOCDIR%%/qtsql/qtsql-tablemodel-tablemodel-pro.html
%%QT_DOCDIR%%/qtsql/qtsql.index
%%QT_DOCDIR%%/qtsql/qtsql.qhp
%%QT_DOCDIR%%/qtsql/qtsql.qhp.sha1
%%QT_DOCDIR%%/qtsql/qtsql.tags
%%QT_DOCDIR%%/qtsql/sql-connecting.html
%%QT_DOCDIR%%/qtsql/sql-driver.html
%%QT_DOCDIR%%/qtsql/sql-forms.html
%%QT_DOCDIR%%/qtsql/sql-model.html
%%QT_DOCDIR%%/qtsql/sql-presenting.html
%%QT_DOCDIR%%/qtsql/sql-programming.html
%%QT_DOCDIR%%/qtsql/sql-sqlstatements.html
%%QT_DOCDIR%%/qtsql/sql-types.html
%%QT_DOCDIR%%/qtsql/style/offline-simple.css
%%QT_DOCDIR%%/qtsql/style/offline.css
%%QT_DOCDIR%%/qtsvg.qch
%%QT_DOCDIR%%/qtsvg/examples-manifest.xml
%%QT_DOCDIR%%/qtsvg/images/arrow_bc.png
%%QT_DOCDIR%%/qtsvg/images/bgrContent.png
%%QT_DOCDIR%%/qtsvg/images/btn_next.png
%%QT_DOCDIR%%/qtsvg/images/btn_prev.png
%%QT_DOCDIR%%/qtsvg/images/bullet_dn.png
%%QT_DOCDIR%%/qtsvg/images/bullet_sq.png
%%QT_DOCDIR%%/qtsvg/images/home.png
%%QT_DOCDIR%%/qtsvg/images/ico_note.png
%%QT_DOCDIR%%/qtsvg/images/ico_note_attention.png
%%QT_DOCDIR%%/qtsvg/images/ico_out.png
%%QT_DOCDIR%%/qtsvg/images/logo.png
%%QT_DOCDIR%%/qtsvg/images/svggenerator-example.png
%%QT_DOCDIR%%/qtsvg/images/svgviewer-example.png
%%QT_DOCDIR%%/qtsvg/images/textobject-example.png
%%QT_DOCDIR%%/qtsvg/qgraphicssvgitem-members.html
%%QT_DOCDIR%%/qtsvg/qgraphicssvgitem-obsolete.html
%%QT_DOCDIR%%/qtsvg/qgraphicssvgitem.html
%%QT_DOCDIR%%/qtsvg/qsvggenerator-members.html
%%QT_DOCDIR%%/qtsvg/qsvggenerator.html
%%QT_DOCDIR%%/qtsvg/qsvgrenderer-members.html
%%QT_DOCDIR%%/qtsvg/qsvgrenderer.html
%%QT_DOCDIR%%/qtsvg/qsvgwidget-members.html
%%QT_DOCDIR%%/qtsvg/qsvgwidget.html
%%QT_DOCDIR%%/qtsvg/qtsvg-index.html
%%QT_DOCDIR%%/qtsvg/qtsvg-module.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-example.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-files-heart-svg.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-main-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-resources-qrc.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-svgtextobject-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-svgtextobject-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-textobject-pro.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-window-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-richtext-textobject-window-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-displaywidget-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-displaywidget-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-example.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-forms-window-ui.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-main-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-svggenerator-pro.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-svggenerator-qrc.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-window-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svggenerator-window-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-example.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-exportdialog-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-exportdialog-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-files-bubbles-svg.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-files-cubic-svg.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-files-spheres-svg.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-main-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-mainwindow-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-mainwindow-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-svgview-cpp.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-svgview-h.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-svgviewer-pro.html
%%QT_DOCDIR%%/qtsvg/qtsvg-svgviewer-svgviewer-qrc.html
%%QT_DOCDIR%%/qtsvg/qtsvg.index
%%QT_DOCDIR%%/qtsvg/qtsvg.qhp
%%QT_DOCDIR%%/qtsvg/qtsvg.qhp.sha1
%%QT_DOCDIR%%/qtsvg/qtsvg.tags
%%QT_DOCDIR%%/qtsvg/qtsvglicense.html
%%QT_DOCDIR%%/qtsvg/style/offline-simple.css
%%QT_DOCDIR%%/qtsvg/style/offline.css
%%QT_DOCDIR%%/qtsvg/svgrendering.html
%%QT_DOCDIR%%/qttestlib.qch
%%QT_DOCDIR%%/qttestlib/examples-manifest.xml
%%QT_DOCDIR%%/qttestlib/images/arrow_bc.png
%%QT_DOCDIR%%/qttestlib/images/bgrContent.png
%%QT_DOCDIR%%/qttestlib/images/btn_next.png
%%QT_DOCDIR%%/qttestlib/images/btn_prev.png
%%QT_DOCDIR%%/qttestlib/images/bullet_dn.png
%%QT_DOCDIR%%/qttestlib/images/bullet_sq.png
%%QT_DOCDIR%%/qttestlib/images/home.png
%%QT_DOCDIR%%/qttestlib/images/ico_note.png
%%QT_DOCDIR%%/qttestlib/images/ico_note_attention.png
%%QT_DOCDIR%%/qttestlib/images/ico_out.png
%%QT_DOCDIR%%/qttestlib/images/logo.png
%%QT_DOCDIR%%/qttestlib/qsignalspy-members.html
%%QT_DOCDIR%%/qttestlib/qsignalspy.html
%%QT_DOCDIR%%/qttestlib/qtest-obsolete.html
%%QT_DOCDIR%%/qttestlib/qtest-overview.html
%%QT_DOCDIR%%/qttestlib/qtest-qtoucheventsequence-members.html
%%QT_DOCDIR%%/qttestlib/qtest-qtoucheventsequence.html
%%QT_DOCDIR%%/qttestlib/qtest-tutorial.html
%%QT_DOCDIR%%/qttestlib/qtest.html
%%QT_DOCDIR%%/qttestlib/qtesteventlist-members.html
%%QT_DOCDIR%%/qttestlib/qtesteventlist.html
%%QT_DOCDIR%%/qttestlib/qttest-index.html
%%QT_DOCDIR%%/qttestlib/qttest-module.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial1-example.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial1-testqstring-cpp.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial1-tutorial1-pro.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial2-example.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial2-testqstring-cpp.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial2-tutorial2-pro.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial3-example.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial3-testgui-cpp.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial3-tutorial3-pro.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial4-example.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial4-testgui-cpp.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial4-tutorial4-pro.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial5-benchmarking-cpp.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial5-example.html
%%QT_DOCDIR%%/qttestlib/qttestlib-tutorial5-tutorial5-pro.html
%%QT_DOCDIR%%/qttestlib/qttestlib.index
%%QT_DOCDIR%%/qttestlib/qttestlib.qhp
%%QT_DOCDIR%%/qttestlib/qttestlib.qhp.sha1
%%QT_DOCDIR%%/qttestlib/qttestlib.tags
%%QT_DOCDIR%%/qttestlib/style/offline-simple.css
%%QT_DOCDIR%%/qttestlib/style/offline.css
%%QT_DOCDIR%%/qtuitools.qch
%%QT_DOCDIR%%/qtuitools/examples-manifest.xml
%%QT_DOCDIR%%/qtuitools/examples-qtuitools.html
%%QT_DOCDIR%%/qtuitools/images/arrow_bc.png
%%QT_DOCDIR%%/qtuitools/images/bgrContent.png
%%QT_DOCDIR%%/qtuitools/images/btn_next.png
%%QT_DOCDIR%%/qtuitools/images/btn_prev.png
%%QT_DOCDIR%%/qtuitools/images/bullet_dn.png
%%QT_DOCDIR%%/qtuitools/images/bullet_sq.png
%%QT_DOCDIR%%/qtuitools/images/home.png
%%QT_DOCDIR%%/qtuitools/images/ico_note.png
%%QT_DOCDIR%%/qtuitools/images/ico_note_attention.png
%%QT_DOCDIR%%/qtuitools/images/ico_out.png
%%QT_DOCDIR%%/qtuitools/images/logo.png
%%QT_DOCDIR%%/qtuitools/images/multipleinheritance-example.png
%%QT_DOCDIR%%/qtuitools/images/textfinder-example-find.png
%%QT_DOCDIR%%/qtuitools/images/textfinder-example-find2.png
%%QT_DOCDIR%%/qtuitools/images/textfinder-example-userinterface.png
%%QT_DOCDIR%%/qtuitools/images/uitools-examples.png
%%QT_DOCDIR%%/qtuitools/qtuitools-index.html
%%QT_DOCDIR%%/qtuitools/qtuitools-module.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-calculatorform-cpp.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-calculatorform-h.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-calculatorform-ui.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-example.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-main-cpp.html
%%QT_DOCDIR%%/qtuitools/qtuitools-multipleinheritance-multipleinheritance-pro.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-example.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-forms-textfinder-ui.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-main-cpp.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-textfinder-cpp.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-textfinder-h.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-textfinder-pro.html
%%QT_DOCDIR%%/qtuitools/qtuitools-textfinder-textfinder-qrc.html
%%QT_DOCDIR%%/qtuitools/qtuitools.index
%%QT_DOCDIR%%/qtuitools/qtuitools.qhp
%%QT_DOCDIR%%/qtuitools/qtuitools.qhp.sha1
%%QT_DOCDIR%%/qtuitools/quiloader-members.html
%%QT_DOCDIR%%/qtuitools/quiloader.html
%%QT_DOCDIR%%/qtuitools/style/offline-simple.css
%%QT_DOCDIR%%/qtuitools/style/offline.css
%%QT_DOCDIR%%/qtvirtualkeyboard.qch
%%QT_DOCDIR%%/qtvirtualkeyboard/build.html
%%QT_DOCDIR%%/qtvirtualkeyboard/deployment-guide.html
%%QT_DOCDIR%%/qtvirtualkeyboard/examples-manifest.xml
%%QT_DOCDIR%%/qtvirtualkeyboard/images/arrow_bc.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/basic-example.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/bgrContent.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/btn_next.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/btn_prev.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/bullet_dn.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/bullet_sq.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-double-left.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-double-up.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-single-down-left.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-single-left.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-single-right.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/gesture-single-up.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/handwriting-mode-icon.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/home.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/ico_note.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/ico_note_attention.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/ico_out.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/language-icon.png
%%QT_DOCDIR%%/qtvirtualkeyboard/images/logo.png
%%QT_DOCDIR%%/qtvirtualkeyboard/inputframework-module.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-backspacekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-backspacekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-basekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-basekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-changelanguagekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-changelanguagekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-fillerkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-fillerkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritingmodekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritingmodekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-hidekeyboardkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-hidekeyboardkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-key-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-key.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardcolumn-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardcolumn.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayout-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayout.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayoutloader-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayoutloader.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardrow-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardrow.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-modekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-modekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-numberkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-numberkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shiftkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shiftkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-spacekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-spacekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-symbolmodekey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-symbolmodekey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputarea-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputarea.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputkey-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputkey.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qt-virtual-keyboard-qmltypes.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtquick-virtualkeyboard-qmlmodule.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtquick-virtualkeyboard-settings-qmlmodule.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtquick-virtualkeyboard-styles-qmlmodule.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-basic-b2qt-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-basic-pro.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-basic-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-autoscroller-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-floatingbutton-active-svg.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-floatingbutton-available-svg.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-floatingbutton-unavailable-svg.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-handwritingmodebutton-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-scrollbar-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-textarea-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-textbase-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-content-textfield-qml.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-demo-qrc.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-example.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-basic-main-cpp.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-examples.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-index.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-inputcontext-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-inputcontext.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-inputengine-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-inputengine.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-selectionlistmodel-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-selectionlistmodel.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-shifthandler-members.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-shifthandler.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard-user-guide.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard.html
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard.index
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard.qhp
%%QT_DOCDIR%%/qtvirtualkeyboard/qtvirtualkeyboard.qhp.sha1
%%QT_DOCDIR%%/qtvirtualkeyboard/style/offline-simple.css
%%QT_DOCDIR%%/qtvirtualkeyboard/style/offline.css
%%QT_DOCDIR%%/qtvirtualkeyboard/technical-guide.html
%%QT_DOCDIR%%/qtwebchannel.qch
%%QT_DOCDIR%%/qtwebchannel/examples-manifest.xml
%%QT_DOCDIR%%/qtwebchannel/images/arrow_bc.png
%%QT_DOCDIR%%/qtwebchannel/images/bgrContent.png
%%QT_DOCDIR%%/qtwebchannel/images/btn_next.png
%%QT_DOCDIR%%/qtwebchannel/images/btn_prev.png
%%QT_DOCDIR%%/qtwebchannel/images/bullet_dn.png
%%QT_DOCDIR%%/qtwebchannel/images/bullet_sq.png
%%QT_DOCDIR%%/qtwebchannel/images/chatclient-html.png
%%QT_DOCDIR%%/qtwebchannel/images/chatclient-qml.png
%%QT_DOCDIR%%/qtwebchannel/images/chatserver-cpp.png
%%QT_DOCDIR%%/qtwebchannel/images/home.png
%%QT_DOCDIR%%/qtwebchannel/images/ico_note.png
%%QT_DOCDIR%%/qtwebchannel/images/ico_note_attention.png
%%QT_DOCDIR%%/qtwebchannel/images/ico_out.png
%%QT_DOCDIR%%/qtwebchannel/images/logo.png
%%QT_DOCDIR%%/qtwebchannel/images/standalone-screenshot.png
%%QT_DOCDIR%%/qtwebchannel/qml-qtwebchannel-webchannel-members.html
%%QT_DOCDIR%%/qtwebchannel/qml-qtwebchannel-webchannel.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html-pro.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-html-example.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-qml-chatclient-qml-pro.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-qml-example.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatclient-qml-qmlchatclient-qml.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp-pro.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-h.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-chatserver-cpp-main-cpp.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-examples.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-index.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-javascript.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-module.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-qmlmodule.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-standalone-dialog-ui.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-standalone-example.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-standalone-index-html.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-standalone-main-cpp.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel-standalone-standalone-pro.html
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel.index
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel.qhp
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel.qhp.sha1
%%QT_DOCDIR%%/qtwebchannel/qtwebchannel.tags
%%QT_DOCDIR%%/qtwebchannel/qwebchannel-members.html
%%QT_DOCDIR%%/qtwebchannel/qwebchannel.html
%%QT_DOCDIR%%/qtwebchannel/qwebchannelabstracttransport-members.html
%%QT_DOCDIR%%/qtwebchannel/qwebchannelabstracttransport.html
%%QT_DOCDIR%%/qtwebchannel/style/offline-simple.css
%%QT_DOCDIR%%/qtwebchannel/style/offline.css
%%QT_DOCDIR%%/qtwebsockets.qch
%%QT_DOCDIR%%/qtwebsockets/echoclient.html
%%QT_DOCDIR%%/qtwebsockets/echoserver.html
%%QT_DOCDIR%%/qtwebsockets/examples-manifest.xml
%%QT_DOCDIR%%/qtwebsockets/images/arrow_bc.png
%%QT_DOCDIR%%/qtwebsockets/images/bgrContent.png
%%QT_DOCDIR%%/qtwebsockets/images/btn_next.png
%%QT_DOCDIR%%/qtwebsockets/images/btn_prev.png
%%QT_DOCDIR%%/qtwebsockets/images/bullet_dn.png
%%QT_DOCDIR%%/qtwebsockets/images/bullet_sq.png
%%QT_DOCDIR%%/qtwebsockets/images/echoclient-html-example.png
%%QT_DOCDIR%%/qtwebsockets/images/home.png
%%QT_DOCDIR%%/qtwebsockets/images/ico_note.png
%%QT_DOCDIR%%/qtwebsockets/images/ico_note_attention.png
%%QT_DOCDIR%%/qtwebsockets/images/ico_out.png
%%QT_DOCDIR%%/qtwebsockets/images/logo.png
%%QT_DOCDIR%%/qtwebsockets/images/websockets-pictorial-representation.jpg
%%QT_DOCDIR%%/qtwebsockets/qmaskgenerator-members.html
%%QT_DOCDIR%%/qtwebsockets/qmaskgenerator.html
%%QT_DOCDIR%%/qtwebsockets/qml-qtwebsockets-websocket-members.html
%%QT_DOCDIR%%/qtwebsockets/qml-qtwebsockets-websocket.html
%%QT_DOCDIR%%/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
%%QT_DOCDIR%%/qtwebsockets/qml-qtwebsockets-websocketserver.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoclient-echoclient-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoclient-echoclient-h.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoclient-echoclient-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoclient-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoclient-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-echoclient-html.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-echoserver-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-echoserver-h.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-echoserver-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-echoserver-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-examples.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-index.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-module.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlmodule.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketclient-data-qrc.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketclient-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketclient-qml-qmlwebsocketclient-main-qml.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketclient-qmlwebsocketclient-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketserver-data-qrc.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketserver-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketserver-qml-qmlwebsocketserver-main-qml.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-qmlwebsocketserver-qmlwebsocketserver-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-chatclient-html.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-chatserver-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-chatserver-h.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-simplechat-simplechat-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoclient-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoclient-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-h.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-example.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-main-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-securesocketclient-qrc.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-sslechoclient-html.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-cpp.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-h.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-pro.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets-testing.html
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets.index
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets.qhp
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets.qhp.sha1
%%QT_DOCDIR%%/qtwebsockets/qtwebsockets.tags
%%QT_DOCDIR%%/qtwebsockets/qwebsocket-members.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocket.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocketcorsauthenticator-members.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocketcorsauthenticator.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocketprotocol.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocketserver-members.html
%%QT_DOCDIR%%/qtwebsockets/qwebsocketserver.html
%%QT_DOCDIR%%/qtwebsockets/style/offline-simple.css
%%QT_DOCDIR%%/qtwebsockets/style/offline.css
%%QT_DOCDIR%%/qtwebsockets/websockets-overview.html
%%QT_DOCDIR%%/qtwidgets.qch
%%QT_DOCDIR%%/qtwidgets/application-windows.html
%%QT_DOCDIR%%/qtwidgets/dialogs.html
%%QT_DOCDIR%%/qtwidgets/examples-desktop.html
%%QT_DOCDIR%%/qtwidgets/examples-dialogs.html
%%QT_DOCDIR%%/qtwidgets/examples-graphicsview.html
%%QT_DOCDIR%%/qtwidgets/examples-itemviews.html
%%QT_DOCDIR%%/qtwidgets/examples-mainwindow.html
%%QT_DOCDIR%%/qtwidgets/examples-manifest.xml
%%QT_DOCDIR%%/qtwidgets/examples-painting.html
%%QT_DOCDIR%%/qtwidgets/examples-richtext.html
%%QT_DOCDIR%%/qtwidgets/examples-widgets.html
%%QT_DOCDIR%%/qtwidgets/focus.html
%%QT_DOCDIR%%/qtwidgets/gallery-fusion.html
%%QT_DOCDIR%%/qtwidgets/gallery-macintosh.html
%%QT_DOCDIR%%/qtwidgets/gallery-windows.html
%%QT_DOCDIR%%/qtwidgets/gallery-windowsvista.html
%%QT_DOCDIR%%/qtwidgets/gallery-windowsxp.html
%%QT_DOCDIR%%/qtwidgets/gallery.html
%%QT_DOCDIR%%/qtwidgets/gestures-overview.html
%%QT_DOCDIR%%/qtwidgets/graphicsview.html
%%QT_DOCDIR%%/qtwidgets/guibooks.html
%%QT_DOCDIR%%/qtwidgets/images/addressbook-adddialog.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-classes.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-editdialog.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-example.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-filemenu.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-newaddresstab.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-signals.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-toolsmenu.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part1-labeled-layout.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part1-labeled-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part1-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-add-contact.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-add-flowchart.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-add-successful.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-labeled-layout.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-signals-and-slots.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part2-stretch-effects.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part3-labeled-layout.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part3-linkedlist.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part3-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part4-remove.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part5-finddialog.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part5-notfound.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part5-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part5-signals-and-slots.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part6-load.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part6-save.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part6-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-part7-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/addressbook-tutorial-screenshot.png
%%QT_DOCDIR%%/qtwidgets/images/affine-demo.png
%%QT_DOCDIR%%/qtwidgets/images/analogclock-example.png
%%QT_DOCDIR%%/qtwidgets/images/analogclock-viewport.png
%%QT_DOCDIR%%/qtwidgets/images/animatedtiles-example.png
%%QT_DOCDIR%%/qtwidgets/images/appchooser-example.png
%%QT_DOCDIR%%/qtwidgets/images/application-menus.png
%%QT_DOCDIR%%/qtwidgets/images/application.png
%%QT_DOCDIR%%/qtwidgets/images/arrow_bc.png
%%QT_DOCDIR%%/qtwidgets/images/assistant-toolbar.png
%%QT_DOCDIR%%/qtwidgets/images/basicdrawing-example.png
%%QT_DOCDIR%%/qtwidgets/images/basicgraphicslayouts-example.png
%%QT_DOCDIR%%/qtwidgets/images/basiclayouts-example.png
%%QT_DOCDIR%%/qtwidgets/images/basicsortfiltermodel-example.png
%%QT_DOCDIR%%/qtwidgets/images/bgrContent.png
%%QT_DOCDIR%%/qtwidgets/images/blurpickereffect-example.png
%%QT_DOCDIR%%/qtwidgets/images/borderlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/boxes-demo.png
%%QT_DOCDIR%%/qtwidgets/images/branchindicatorimage.png
%%QT_DOCDIR%%/qtwidgets/images/btn_next.png
%%QT_DOCDIR%%/qtwidgets/images/btn_prev.png
%%QT_DOCDIR%%/qtwidgets/images/bullet_dn.png
%%QT_DOCDIR%%/qtwidgets/images/bullet_sq.png
%%QT_DOCDIR%%/qtwidgets/images/button.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-gnomelayout-vertical.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-kdelayout-horizontal.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-kdelayout-vertical.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-mac-modeless-vertical.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-maclayout-horizontal.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-maclayout-vertical.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-winlayout-horizontal.png
%%QT_DOCDIR%%/qtwidgets/images/buttonbox-winlayout-vertical.png
%%QT_DOCDIR%%/qtwidgets/images/calculator-example.png
%%QT_DOCDIR%%/qtwidgets/images/calculator-ugly.png
%%QT_DOCDIR%%/qtwidgets/images/calendar-example.png
%%QT_DOCDIR%%/qtwidgets/images/calendarwidgetexample.png
%%QT_DOCDIR%%/qtwidgets/images/charactermap-example.png
%%QT_DOCDIR%%/qtwidgets/images/chart-example.png
%%QT_DOCDIR%%/qtwidgets/images/checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/checkboxes-exclusive.png
%%QT_DOCDIR%%/qtwidgets/images/checkboxes-non-exclusive.png
%%QT_DOCDIR%%/qtwidgets/images/checkboxexample.png
%%QT_DOCDIR%%/qtwidgets/images/chip-demo.png
%%QT_DOCDIR%%/qtwidgets/images/classwizard-flow.png
%%QT_DOCDIR%%/qtwidgets/images/classwizard.png
%%QT_DOCDIR%%/qtwidgets/images/clock.png
%%QT_DOCDIR%%/qtwidgets/images/codecs-example.png
%%QT_DOCDIR%%/qtwidgets/images/codeeditor-example.png
%%QT_DOCDIR%%/qtwidgets/images/collidingmice-example.png
%%QT_DOCDIR%%/qtwidgets/images/coloreditorfactoryimage.png
%%QT_DOCDIR%%/qtwidgets/images/columnview.png
%%QT_DOCDIR%%/qtwidgets/images/combobox.png
%%QT_DOCDIR%%/qtwidgets/images/comboboximage.png
%%QT_DOCDIR%%/qtwidgets/images/combowidgetmapper-example.png
%%QT_DOCDIR%%/qtwidgets/images/completer-example-country.png
%%QT_DOCDIR%%/qtwidgets/images/completer-example-dirmodel.png
%%QT_DOCDIR%%/qtwidgets/images/completer-example-qdirmodel.png
%%QT_DOCDIR%%/qtwidgets/images/completer-example-word.png
%%QT_DOCDIR%%/qtwidgets/images/completer-example.png
%%QT_DOCDIR%%/qtwidgets/images/composition-demo.png
%%QT_DOCDIR%%/qtwidgets/images/concentriccircles-example.png
%%QT_DOCDIR%%/qtwidgets/images/conceptualpushbuttontree.png
%%QT_DOCDIR%%/qtwidgets/images/configdialog-example.png
%%QT_DOCDIR%%/qtwidgets/images/customcompleter-example.png
%%QT_DOCDIR%%/qtwidgets/images/customcompleter-insertcompletion.png
%%QT_DOCDIR%%/qtwidgets/images/customsortfiltermodel-example.png
%%QT_DOCDIR%%/qtwidgets/images/deform-demo.png
%%QT_DOCDIR%%/qtwidgets/images/designer-stylesheet-options.png
%%QT_DOCDIR%%/qtwidgets/images/designer-stylesheet-usage.png
%%QT_DOCDIR%%/qtwidgets/images/designer-validator-highlighter.png
%%QT_DOCDIR%%/qtwidgets/images/desktop-examples.png
%%QT_DOCDIR%%/qtwidgets/images/diagramscene.png
%%QT_DOCDIR%%/qtwidgets/images/dialog-examples.png
%%QT_DOCDIR%%/qtwidgets/images/digitalclock-example.png
%%QT_DOCDIR%%/qtwidgets/images/dirview-example.png
%%QT_DOCDIR%%/qtwidgets/images/dockwidget.png
%%QT_DOCDIR%%/qtwidgets/images/dockwidgetimage.png
%%QT_DOCDIR%%/qtwidgets/images/dockwidgets-example.png
%%QT_DOCDIR%%/qtwidgets/images/draganddroppuzzle-example.png
%%QT_DOCDIR%%/qtwidgets/images/dragdroprobot-example.png
%%QT_DOCDIR%%/qtwidgets/images/draggableicons-example.png
%%QT_DOCDIR%%/qtwidgets/images/draggabletext-example.png
%%QT_DOCDIR%%/qtwidgets/images/dropsite-example.png
%%QT_DOCDIR%%/qtwidgets/images/dummy_tree.png
%%QT_DOCDIR%%/qtwidgets/images/easing-example.png
%%QT_DOCDIR%%/qtwidgets/images/echopluginexample.png
%%QT_DOCDIR%%/qtwidgets/images/elasticnodes-example.png
%%QT_DOCDIR%%/qtwidgets/images/elidedlabel-example.png
%%QT_DOCDIR%%/qtwidgets/images/embeddeddialogs-demo.png
%%QT_DOCDIR%%/qtwidgets/images/example_model.png
%%QT_DOCDIR%%/qtwidgets/images/extension-example.png
%%QT_DOCDIR%%/qtwidgets/images/extension_more.png
%%QT_DOCDIR%%/qtwidgets/images/factorial-example.png
%%QT_DOCDIR%%/qtwidgets/images/fademessageeffect-example-faded.png
%%QT_DOCDIR%%/qtwidgets/images/fademessageeffect-example.png
%%QT_DOCDIR%%/qtwidgets/images/fetchmore-example.png
%%QT_DOCDIR%%/qtwidgets/images/filedialogurls.png
%%QT_DOCDIR%%/qtwidgets/images/findfiles-example.png
%%QT_DOCDIR%%/qtwidgets/images/findfiles_progress_dialog.png
%%QT_DOCDIR%%/qtwidgets/images/flowlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/fontsampler-example.png
%%QT_DOCDIR%%/qtwidgets/images/frames.png
%%QT_DOCDIR%%/qtwidgets/images/fridgemagnets-example.png
%%QT_DOCDIR%%/qtwidgets/images/frozencolumn-example.png
%%QT_DOCDIR%%/qtwidgets/images/frozencolumn-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-calendarwidget.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-colordialog.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-dateedit.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-datetimeedit.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-dial.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-doublespinbox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-fontcombobox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-fontdialog.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-frame.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-horizontalscrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-label.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-lcdnumber.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-lineedit.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-listview.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-menu.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-progressdialog.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-pushbutton-menu.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-radiobutton.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-slider.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-statusbar-sizegrip.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-tabbar-truncated.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-tabbar.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-textedit.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-timeedit.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/fusion-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/geometry.png
%%QT_DOCDIR%%/qtwidgets/images/gradients-demo.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsanchorlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-blur.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-colorize.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-drop-shadow.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-opacity.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-plain.png
%%QT_DOCDIR%%/qtwidgets/images/graphicseffect-widget.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsflowlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/graphicssimpleanchorlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-ellipseitem-pie.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-ellipseitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-examples.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-items.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-lineitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-parentchild.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-pathitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-pixmapitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-polygonitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-rectitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-simpletextitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-textitem.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-view.png
%%QT_DOCDIR%%/qtwidgets/images/graphicsview-zorder.png
%%QT_DOCDIR%%/qtwidgets/images/gridlayout.png
%%QT_DOCDIR%%/qtwidgets/images/groupbox-example.png
%%QT_DOCDIR%%/qtwidgets/images/groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/groupboximage.png
%%QT_DOCDIR%%/qtwidgets/images/header.png
%%QT_DOCDIR%%/qtwidgets/images/headerimage.png
%%QT_DOCDIR%%/qtwidgets/images/home.png
%%QT_DOCDIR%%/qtwidgets/images/i18n-example.png
%%QT_DOCDIR%%/qtwidgets/images/ico_note.png
%%QT_DOCDIR%%/qtwidgets/images/ico_note_attention.png
%%QT_DOCDIR%%/qtwidgets/images/ico_out.png
%%QT_DOCDIR%%/qtwidgets/images/icons-example.png
%%QT_DOCDIR%%/qtwidgets/images/icons-view-menu.png
%%QT_DOCDIR%%/qtwidgets/images/icons_find_normal.png
%%QT_DOCDIR%%/qtwidgets/images/icons_find_normal_disabled.png
%%QT_DOCDIR%%/qtwidgets/images/icons_images_groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/icons_monkey.png
%%QT_DOCDIR%%/qtwidgets/images/icons_monkey_active.png
%%QT_DOCDIR%%/qtwidgets/images/icons_monkey_mess.png
%%QT_DOCDIR%%/qtwidgets/images/icons_preview_area.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_16x16.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_17x17.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_32x32.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_33x33.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_48x48.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_64x64.png
%%QT_DOCDIR%%/qtwidgets/images/icons_qt_extended_8x8.png
%%QT_DOCDIR%%/qtwidgets/images/icons_size_groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/icons_size_spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/imagecomposition-example.png
%%QT_DOCDIR%%/qtwidgets/images/imagegestures-example.jpg
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-example.png
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-fit_to_window_1.png
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-fit_to_window_2.png
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-original_size.png
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-zoom_in_1.png
%%QT_DOCDIR%%/qtwidgets/images/imageviewer-zoom_in_2.png
%%QT_DOCDIR%%/qtwidgets/images/inputdialogs.png
%%QT_DOCDIR%%/qtwidgets/images/interview-demo.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-editabletreemodel-indexes.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-editabletreemodel-items.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-editabletreemodel-model.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-editabletreemodel-values.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-editabletreemodel.png
%%QT_DOCDIR%%/qtwidgets/images/itemviews-examples.png
%%QT_DOCDIR%%/qtwidgets/images/itemviewspuzzle-example.png
%%QT_DOCDIR%%/qtwidgets/images/layout1.png
%%QT_DOCDIR%%/qtwidgets/images/layout2.png
%%QT_DOCDIR%%/qtwidgets/images/licensewizard-example.png
%%QT_DOCDIR%%/qtwidgets/images/licensewizard-flow.png
%%QT_DOCDIR%%/qtwidgets/images/lightingeffect-example.png
%%QT_DOCDIR%%/qtwidgets/images/lineedits-example.png
%%QT_DOCDIR%%/qtwidgets/images/list_table_tree.png
%%QT_DOCDIR%%/qtwidgets/images/listview.png
%%QT_DOCDIR%%/qtwidgets/images/logo.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-calendarwidget.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-dateedit.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-datetimeedit.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-dial.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-doublespinbox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-fontcombobox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-frame.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-horizontalscrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-label.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-lcdnumber.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-lineedit.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-listview.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-menu.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-radiobutton.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-slider.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-textedit.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-timeedit.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/macintosh-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/mainwindow-demo.png
%%QT_DOCDIR%%/qtwidgets/images/mainwindow-docks-example.png
%%QT_DOCDIR%%/qtwidgets/images/mainwindow-docks.png
%%QT_DOCDIR%%/qtwidgets/images/mainwindow-examples.png
%%QT_DOCDIR%%/qtwidgets/images/mainwindowlayout.png
%%QT_DOCDIR%%/qtwidgets/images/mdi-cascade.png
%%QT_DOCDIR%%/qtwidgets/images/mdi-example.png
%%QT_DOCDIR%%/qtwidgets/images/mdi-tile.png
%%QT_DOCDIR%%/qtwidgets/images/menu.png
%%QT_DOCDIR%%/qtwidgets/images/menubar.png
%%QT_DOCDIR%%/qtwidgets/images/menubarimage.png
%%QT_DOCDIR%%/qtwidgets/images/menuimage.png
%%QT_DOCDIR%%/qtwidgets/images/menus-example.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-header.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-models.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-overview.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-roles.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-tablemodel.png
%%QT_DOCDIR%%/qtwidgets/images/modelview-treemodel.png
%%QT_DOCDIR%%/qtwidgets/images/modelview.png
%%QT_DOCDIR%%/qtwidgets/images/mousebutton-buttontester.png
%%QT_DOCDIR%%/qtwidgets/images/move-blocks-chart.png
%%QT_DOCDIR%%/qtwidgets/images/moveblocks-example.png
%%QT_DOCDIR%%/qtwidgets/images/movie-example.png
%%QT_DOCDIR%%/qtwidgets/images/msgbox1.png
%%QT_DOCDIR%%/qtwidgets/images/msgbox2.png
%%QT_DOCDIR%%/qtwidgets/images/msgbox3.png
%%QT_DOCDIR%%/qtwidgets/images/msgbox4.png
%%QT_DOCDIR%%/qtwidgets/images/orderform-example-detailsdialog.png
%%QT_DOCDIR%%/qtwidgets/images/orderform-example.png
%%QT_DOCDIR%%/qtwidgets/images/padnavigator-example.png
%%QT_DOCDIR%%/qtwidgets/images/painterpaths-example.png
%%QT_DOCDIR%%/qtwidgets/images/painting-examples.png
%%QT_DOCDIR%%/qtwidgets/images/paintsystem-icon.png
%%QT_DOCDIR%%/qtwidgets/images/paintsystem-stylepainter.png
%%QT_DOCDIR%%/qtwidgets/images/pangesture.png
%%QT_DOCDIR%%/qtwidgets/images/parent-child-widgets.png
%%QT_DOCDIR%%/qtwidgets/images/pathstroke-demo.png
%%QT_DOCDIR%%/qtwidgets/images/pinchgesture.png
%%QT_DOCDIR%%/qtwidgets/images/pingpong-example.png
%%QT_DOCDIR%%/qtwidgets/images/pixelator-example.png
%%QT_DOCDIR%%/qtwidgets/images/plugandpaint-plugindialog.png
%%QT_DOCDIR%%/qtwidgets/images/plugandpaint.png
%%QT_DOCDIR%%/qtwidgets/images/progressBar-stylesheet.png
%%QT_DOCDIR%%/qtwidgets/images/progressBar2-stylesheet.png
%%QT_DOCDIR%%/qtwidgets/images/progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/progressbarimage.png
%%QT_DOCDIR%%/qtwidgets/images/propagation-custom.png
%%QT_DOCDIR%%/qtwidgets/images/propagation-standard.png
%%QT_DOCDIR%%/qtwidgets/images/pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/qactiongroup-align.png
%%QT_DOCDIR%%/qtwidgets/images/qcalendarwidget-grid.png
%%QT_DOCDIR%%/qtwidgets/images/qcalendarwidget-maximum.png
%%QT_DOCDIR%%/qtwidgets/images/qcalendarwidget-minimum.png
%%QT_DOCDIR%%/qtwidgets/images/qcolumnview.png
%%QT_DOCDIR%%/qtwidgets/images/qcompleter.png
%%QT_DOCDIR%%/qtwidgets/images/qdesktopwidget.png
%%QT_DOCDIR%%/qtwidgets/images/qerrormessage.png
%%QT_DOCDIR%%/qtwidgets/images/qformlayout-kde.png
%%QT_DOCDIR%%/qtwidgets/images/qformlayout-mac.png
%%QT_DOCDIR%%/qtwidgets/images/qformlayout-qpe.png
%%QT_DOCDIR%%/qtwidgets/images/qformlayout-win.png
%%QT_DOCDIR%%/qtwidgets/images/qformlayout-with-6-children.png
%%QT_DOCDIR%%/qtwidgets/images/qgraphicsproxywidget-embed.png
%%QT_DOCDIR%%/qtwidgets/images/qgridlayout-with-5-children.png
%%QT_DOCDIR%%/qtwidgets/images/qhboxlayout-with-5-children.png
%%QT_DOCDIR%%/qtwidgets/images/qmdisubwindowlayout.png
%%QT_DOCDIR%%/qtwidgets/images/qmessagebox-crit.png
%%QT_DOCDIR%%/qtwidgets/images/qmessagebox-info.png
%%QT_DOCDIR%%/qtwidgets/images/qmessagebox-quest.png
%%QT_DOCDIR%%/qtwidgets/images/qmessagebox-warn.png
%%QT_DOCDIR%%/qtwidgets/images/qscrollarea-noscrollbars.png
%%QT_DOCDIR%%/qtwidgets/images/qscrollarea-onescrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/qscrollarea-twoscrollbars.png
%%QT_DOCDIR%%/qtwidgets/images/qscrollbar-picture.png
%%QT_DOCDIR%%/qtwidgets/images/qscrollbar-values.png
%%QT_DOCDIR%%/qtwidgets/images/qspinbox-plusminus.png
%%QT_DOCDIR%%/qtwidgets/images/qspinbox-updown.png
%%QT_DOCDIR%%/qtwidgets/images/qstyle-comboboxes.png
%%QT_DOCDIR%%/qtwidgets/images/qstyleoptiontoolbar-position.png
%%QT_DOCDIR%%/qtwidgets/images/qtableview-resized.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-aero1.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-aero2.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-classic1.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-classic2.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-mac1.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-mac2.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-macpage.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-modern1.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-modern2.png
%%QT_DOCDIR%%/qtwidgets/images/qtwizard-nonmacpage.png
%%QT_DOCDIR%%/qtwidgets/images/qundoview.png
%%QT_DOCDIR%%/qtwidgets/images/qvboxlayout-with-5-children.png
%%QT_DOCDIR%%/qtwidgets/images/readonlytable_role.png
%%QT_DOCDIR%%/qtwidgets/images/regexp-example.png
%%QT_DOCDIR%%/qtwidgets/images/regularexpression-example.png
%%QT_DOCDIR%%/qtwidgets/images/richtext-examples.png
%%QT_DOCDIR%%/qtwidgets/images/rogue-example.png
%%QT_DOCDIR%%/qtwidgets/images/rogue-statechart.png
%%QT_DOCDIR%%/qtwidgets/images/rubberband.png
%%QT_DOCDIR%%/qtwidgets/images/rubberbandimage.png
%%QT_DOCDIR%%/qtwidgets/images/screenshot-example.png
%%QT_DOCDIR%%/qtwidgets/images/scribble-example.png
%%QT_DOCDIR%%/qtwidgets/images/scrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/scrollbarimage.png
%%QT_DOCDIR%%/qtwidgets/images/sdi-example.png
%%QT_DOCDIR%%/qtwidgets/images/selected-items1.png
%%QT_DOCDIR%%/qtwidgets/images/selected-items2.png
%%QT_DOCDIR%%/qtwidgets/images/selected-items3.png
%%QT_DOCDIR%%/qtwidgets/images/selection-extended.png
%%QT_DOCDIR%%/qtwidgets/images/selection-multi.png
%%QT_DOCDIR%%/qtwidgets/images/selection-single.png
%%QT_DOCDIR%%/qtwidgets/images/selection2.png
%%QT_DOCDIR%%/qtwidgets/images/settingseditor-example.png
%%QT_DOCDIR%%/qtwidgets/images/shapedclock-dragging.png
%%QT_DOCDIR%%/qtwidgets/images/shapedclock-example.png
%%QT_DOCDIR%%/qtwidgets/images/shareddirmodel.png
%%QT_DOCDIR%%/qtwidgets/images/sharedmodel-tableviews.png
%%QT_DOCDIR%%/qtwidgets/images/sharedselection-tableviews.png
%%QT_DOCDIR%%/qtwidgets/images/signals-n-slots-aw-nat.png
%%QT_DOCDIR%%/qtwidgets/images/simpleanchorlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/simpledommodel-example.png
%%QT_DOCDIR%%/qtwidgets/images/simpletreemodel-example.png
%%QT_DOCDIR%%/qtwidgets/images/simplewidgetmapper-example.png
%%QT_DOCDIR%%/qtwidgets/images/sipdialog-closed.png
%%QT_DOCDIR%%/qtwidgets/images/sipdialog-opened.png
%%QT_DOCDIR%%/qtwidgets/images/sizegrip.png
%%QT_DOCDIR%%/qtwidgets/images/sizegripimage.png
%%QT_DOCDIR%%/qtwidgets/images/slider.png
%%QT_DOCDIR%%/qtwidgets/images/sliderimage.png
%%QT_DOCDIR%%/qtwidgets/images/sliders-example.png
%%QT_DOCDIR%%/qtwidgets/images/spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/spinboxdelegate-example.png
%%QT_DOCDIR%%/qtwidgets/images/spinboxes-example.png
%%QT_DOCDIR%%/qtwidgets/images/spinboximage.png
%%QT_DOCDIR%%/qtwidgets/images/spreadsheet-demo.png
%%QT_DOCDIR%%/qtwidgets/images/standard-views.png
%%QT_DOCDIR%%/qtwidgets/images/standarddialogs-example.png
%%QT_DOCDIR%%/qtwidgets/images/standardwidget.png
%%QT_DOCDIR%%/qtwidgets/images/stardelegate.png
%%QT_DOCDIR%%/qtwidgets/images/states-example.png
%%QT_DOCDIR%%/qtwidgets/images/stickman-example.png
%%QT_DOCDIR%%/qtwidgets/images/stickman-example1.png
%%QT_DOCDIR%%/qtwidgets/images/stickman-example2.png
%%QT_DOCDIR%%/qtwidgets/images/stickman-example3.png
%%QT_DOCDIR%%/qtwidgets/images/stringlistmodel.png
%%QT_DOCDIR%%/qtwidgets/images/stylepluginexample.png
%%QT_DOCDIR%%/qtwidgets/images/styles-3d.png
%%QT_DOCDIR%%/qtwidgets/images/styles-aliasing.png
%%QT_DOCDIR%%/qtwidgets/images/styles-disabledwood.png
%%QT_DOCDIR%%/qtwidgets/images/styles-enabledwood.png
%%QT_DOCDIR%%/qtwidgets/images/styles-woodbuttons.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-border-image-normal.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-border-image-stretched.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-border-image-wrong.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-boxmodel.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-branch-closed.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-branch-end.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-branch-more.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-branch-open.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-coffee-cleanlooks.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-coffee-xp.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-pagefold-mac.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-pagefold.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-redbutton1.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-redbutton2.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-redbutton3.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-scrollbar1.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-scrollbar2.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/stylesheet-vline.png
%%QT_DOCDIR%%/qtwidgets/images/sub-attaq-demo.png
%%QT_DOCDIR%%/qtwidgets/images/swipegesture.png
%%QT_DOCDIR%%/qtwidgets/images/syntaxhighlighter-example.png
%%QT_DOCDIR%%/qtwidgets/images/system-tray.png
%%QT_DOCDIR%%/qtwidgets/images/systemtray-editor.png
%%QT_DOCDIR%%/qtwidgets/images/systemtray-example.png
%%QT_DOCDIR%%/qtwidgets/images/tab.png
%%QT_DOCDIR%%/qtwidgets/images/tabWidget-stylesheet1.png
%%QT_DOCDIR%%/qtwidgets/images/tabWidget-stylesheet2.png
%%QT_DOCDIR%%/qtwidgets/images/tabWidget-stylesheet3.png
%%QT_DOCDIR%%/qtwidgets/images/tabdialog-example.png
%%QT_DOCDIR%%/qtwidgets/images/tableWidget-stylesheet.png
%%QT_DOCDIR%%/qtwidgets/images/tabletexample.png
%%QT_DOCDIR%%/qtwidgets/images/tableview.png
%%QT_DOCDIR%%/qtwidgets/images/tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/tetrix-example.png
%%QT_DOCDIR%%/qtwidgets/images/textedit-demo.png
%%QT_DOCDIR%%/qtwidgets/images/titlebar.png
%%QT_DOCDIR%%/qtwidgets/images/titlebarimage.png
%%QT_DOCDIR%%/qtwidgets/images/toolbar.png
%%QT_DOCDIR%%/qtwidgets/images/toolbarimage.png
%%QT_DOCDIR%%/qtwidgets/images/toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/toolboximage.png
%%QT_DOCDIR%%/qtwidgets/images/toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/toolbuttonimage.png
%%QT_DOCDIR%%/qtwidgets/images/tooltips-example.png
%%QT_DOCDIR%%/qtwidgets/images/trafficlight-example.png
%%QT_DOCDIR%%/qtwidgets/images/trafficlight-example1.png
%%QT_DOCDIR%%/qtwidgets/images/trafficlight-example2.png
%%QT_DOCDIR%%/qtwidgets/images/transformations-example.png
%%QT_DOCDIR%%/qtwidgets/images/tree_2_with_algorithm.png
%%QT_DOCDIR%%/qtwidgets/images/treemodel-structure.png
%%QT_DOCDIR%%/qtwidgets/images/treemodelcompleter-example.png
%%QT_DOCDIR%%/qtwidgets/images/treeview.png
%%QT_DOCDIR%%/qtwidgets/images/trivialwizard-example-conclusion.png
%%QT_DOCDIR%%/qtwidgets/images/trivialwizard-example-flow.png
%%QT_DOCDIR%%/qtwidgets/images/trivialwizard-example-introduction.png
%%QT_DOCDIR%%/qtwidgets/images/trivialwizard-example-registration.png
%%QT_DOCDIR%%/qtwidgets/images/undodemo.png
%%QT_DOCDIR%%/qtwidgets/images/undoframeworkexample.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/Time-For-Lunch-2.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/centered.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/ellipse.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/figure8.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/kinetic.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/random.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/animatedtiles/images/tile.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/animation/easing/images/qt-logo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/desktop/systray/images/bad.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/desktop/systray/images/heart.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/desktop/systray/images/trash.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/background.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/banner.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo1.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo2.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo3.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark1.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark2.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/configdialog/images/config.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/configdialog/images/query.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/configdialog/images/update.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/logo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/watermark.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/boat.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/car.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/house.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-calculator.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-text-editor.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/background.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/help-browser.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-group-chat.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-mail.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-web-browser.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/office-calendar.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/effects/blurpicker/images/system-users.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/basicgraphicslayouts/images/block.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/collidingmice/images/cheese.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background1.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background2.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background3.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background4.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bold.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bringtofront.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/delete.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/floodfill.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/italic.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linecolor.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linepointer.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/pointer.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/sendtoback.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/textpointer.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/underline.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/dragdroprobot/images/head.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/artsfftscope.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/blue_angle_swirl.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_contacts.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_journal.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_mail.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_notes.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kopeteavailable.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/metacontact_online.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/minitools.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/5days.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/details.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/place.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/tabbar.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/title.jpg
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/weather-few-clouds.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/customsortfiltermodel/images/find.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/interview/images/folder.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/interview/images/interview.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/interview/images/services.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/pixelator/images/qt.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/itemviews/spreadsheet/images/interview.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/copy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/cut.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/new.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/open.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/paste.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/application/images/save.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/new.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/print.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/save.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/undo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/copy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/cut.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/new.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/open.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/paste.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/mdi/images/save.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/copy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/cut.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/new.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/open.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/paste.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/mainwindows/sdi/images/save.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/basicdrawing/images/brick.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/basicdrawing/images/qt-logo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/imagecomposition/images/background.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/imagecomposition/images/blackrectangle.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/imagecomposition/images/butterfly.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/painting/imagecomposition/images/checker.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/logo32.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcopy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcut.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editpaste.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editredo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editundo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/exportpdf.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filenew.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileopen.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileprint.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filesave.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textbold.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textcenter.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textitalic.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textjustify.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textleft.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textright.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textunder.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomin.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomout.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcopy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcut.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editpaste.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editredo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editundo.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/exportpdf.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filenew.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileopen.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileprint.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filesave.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textbold.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textcenter.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textitalic.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textjustify.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textleft.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textright.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textunder.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomin.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomout.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/tools/regularexpression/images/copy.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/tools/undoframework/images/cross.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/designer.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/find_disabled.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/find_normal.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_128x128.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_16x16.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_32x32.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_64x64.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_128x128.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_16x16.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_32x32.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_64x64.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_16x16.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_32x32.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_48x48.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/styles/images/woodbackground.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/styles/images/woodbutton.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow_disabled.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/frame.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pagefold.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/sizegrip.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_off.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_hover.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_off.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_pressed.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow_disabled.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-airbrush.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-eraser.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-felt-marker.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-pencil.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tooltips/images/circle.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tooltips/images/square.png
%%QT_DOCDIR%%/qtwidgets/images/used-in-examples/widgets/tooltips/images/triangle.png
%%QT_DOCDIR%%/qtwidgets/images/weatheranchorlayout-example.png
%%QT_DOCDIR%%/qtwidgets/images/whatsthis.png
%%QT_DOCDIR%%/qtwidgets/images/widget-examples.png
%%QT_DOCDIR%%/qtwidgets/images/widgetdelegate.png
%%QT_DOCDIR%%/qtwidgets/images/widgetmapper-combo-mapping.png
%%QT_DOCDIR%%/qtwidgets/images/widgetmapper-simple-mapping.png
%%QT_DOCDIR%%/qtwidgets/images/widgetmapper.png
%%QT_DOCDIR%%/qtwidgets/images/widgets-tutorial-childwidget.png
%%QT_DOCDIR%%/qtwidgets/images/widgets-tutorial-nestedlayouts.png
%%QT_DOCDIR%%/qtwidgets/images/widgets-tutorial-toplevel.png
%%QT_DOCDIR%%/qtwidgets/images/widgets-tutorial-windowlayout.png
%%QT_DOCDIR%%/qtwidgets/images/wiggly-example.png
%%QT_DOCDIR%%/qtwidgets/images/windowflags-example.png
%%QT_DOCDIR%%/qtwidgets/images/windowflags_controllerwindow.png
%%QT_DOCDIR%%/qtwidgets/images/windowflags_previewwindow.png
%%QT_DOCDIR%%/qtwidgets/images/windows-calendarwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windows-checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-dateedit.png
%%QT_DOCDIR%%/qtwidgets/images/windows-datetimeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windows-dial.png
%%QT_DOCDIR%%/qtwidgets/images/windows-doublespinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-fontcombobox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-frame.png
%%QT_DOCDIR%%/qtwidgets/images/windows-groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-horizontalscrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/windows-label.png
%%QT_DOCDIR%%/qtwidgets/images/windows-lcdnumber.png
%%QT_DOCDIR%%/qtwidgets/images/windows-lineedit.png
%%QT_DOCDIR%%/qtwidgets/images/windows-listview.png
%%QT_DOCDIR%%/qtwidgets/images/windows-progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/windows-pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windows-radiobutton.png
%%QT_DOCDIR%%/qtwidgets/images/windows-slider.png
%%QT_DOCDIR%%/qtwidgets/images/windows-spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/windows-tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windows-textedit.png
%%QT_DOCDIR%%/qtwidgets/images/windows-timeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windows-toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/windows-toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windows-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/windowstabimage.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-calendarwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-dateedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-datetimeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-dial.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-doublespinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-fontcombobox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-frame.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-horizontalscrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-label.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-lcdnumber.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-lineedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-listview.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-radiobutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-slider.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-textedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-timeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsvista-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-calendarwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-checkbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-combobox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-dateedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-datetimeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-dial.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-doublespinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-fontcombobox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-frame.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-groupbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-horizontalscrollbar.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-label.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-lcdnumber.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-lineedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-listview.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-menu.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-progressbar.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-pushbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-radiobutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-slider.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-spinbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-tableview.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-tabwidget.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-textedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-timeedit.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-toolbox.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-toolbutton.png
%%QT_DOCDIR%%/qtwidgets/images/windowsxp-treeview.png
%%QT_DOCDIR%%/qtwidgets/images/woodbackground.png
%%QT_DOCDIR%%/qtwidgets/images/woodbutton.png
%%QT_DOCDIR%%/qtwidgets/layout.html
%%QT_DOCDIR%%/qtwidgets/mainwindow.html
%%QT_DOCDIR%%/qtwidgets/model-view-programming.html
%%QT_DOCDIR%%/qtwidgets/modelview-part2-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/modelview.html
%%QT_DOCDIR%%/qtwidgets/qabstractbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractbutton.html
%%QT_DOCDIR%%/qtwidgets/qabstractgraphicsshapeitem-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractgraphicsshapeitem.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemdelegate-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemdelegate-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemdelegate.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemview-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemview-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qabstractitemview.html
%%QT_DOCDIR%%/qtwidgets/qabstractscrollarea-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractscrollarea.html
%%QT_DOCDIR%%/qtwidgets/qabstractslider-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractslider.html
%%QT_DOCDIR%%/qtwidgets/qabstractspinbox-members.html
%%QT_DOCDIR%%/qtwidgets/qabstractspinbox.html
%%QT_DOCDIR%%/qtwidgets/qaccessiblewidget-members.html
%%QT_DOCDIR%%/qtwidgets/qaccessiblewidget.html
%%QT_DOCDIR%%/qtwidgets/qaction-members.html
%%QT_DOCDIR%%/qtwidgets/qaction.html
%%QT_DOCDIR%%/qtwidgets/qactiongroup-members.html
%%QT_DOCDIR%%/qtwidgets/qactiongroup.html
%%QT_DOCDIR%%/qtwidgets/qapplication-members.html
%%QT_DOCDIR%%/qtwidgets/qapplication-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qapplication.html
%%QT_DOCDIR%%/qtwidgets/qboxlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qboxlayout.html
%%QT_DOCDIR%%/qtwidgets/qbuttongroup-members.html
%%QT_DOCDIR%%/qtwidgets/qbuttongroup.html
%%QT_DOCDIR%%/qtwidgets/qcalendarwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qcalendarwidget.html
%%QT_DOCDIR%%/qtwidgets/qcheckbox-members.html
%%QT_DOCDIR%%/qtwidgets/qcheckbox.html
%%QT_DOCDIR%%/qtwidgets/qcolordialog-members.html
%%QT_DOCDIR%%/qtwidgets/qcolordialog-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qcolordialog.html
%%QT_DOCDIR%%/qtwidgets/qcolormap-members.html
%%QT_DOCDIR%%/qtwidgets/qcolormap.html
%%QT_DOCDIR%%/qtwidgets/qcolumnview-members.html
%%QT_DOCDIR%%/qtwidgets/qcolumnview.html
%%QT_DOCDIR%%/qtwidgets/qcombobox-members.html
%%QT_DOCDIR%%/qtwidgets/qcombobox-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qcombobox.html
%%QT_DOCDIR%%/qtwidgets/qcommandlinkbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qcommandlinkbutton.html
%%QT_DOCDIR%%/qtwidgets/qcommonstyle-members.html
%%QT_DOCDIR%%/qtwidgets/qcommonstyle.html
%%QT_DOCDIR%%/qtwidgets/qcompleter-members.html
%%QT_DOCDIR%%/qtwidgets/qcompleter.html
%%QT_DOCDIR%%/qtwidgets/qdatawidgetmapper-members.html
%%QT_DOCDIR%%/qtwidgets/qdatawidgetmapper.html
%%QT_DOCDIR%%/qtwidgets/qdateedit-members.html
%%QT_DOCDIR%%/qtwidgets/qdateedit.html
%%QT_DOCDIR%%/qtwidgets/qdatetimeedit-members.html
%%QT_DOCDIR%%/qtwidgets/qdatetimeedit.html
%%QT_DOCDIR%%/qtwidgets/qdesktopwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qdesktopwidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qdesktopwidget.html
%%QT_DOCDIR%%/qtwidgets/qdial-members.html
%%QT_DOCDIR%%/qtwidgets/qdial.html
%%QT_DOCDIR%%/qtwidgets/qdialog-members.html
%%QT_DOCDIR%%/qtwidgets/qdialog-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qdialog.html
%%QT_DOCDIR%%/qtwidgets/qdialogbuttonbox-members.html
%%QT_DOCDIR%%/qtwidgets/qdialogbuttonbox.html
%%QT_DOCDIR%%/qtwidgets/qdirmodel-members.html
%%QT_DOCDIR%%/qtwidgets/qdirmodel.html
%%QT_DOCDIR%%/qtwidgets/qdockwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qdockwidget.html
%%QT_DOCDIR%%/qtwidgets/qdoublespinbox-members.html
%%QT_DOCDIR%%/qtwidgets/qdoublespinbox.html
%%QT_DOCDIR%%/qtwidgets/qdrawutil-h.html
%%QT_DOCDIR%%/qtwidgets/qerrormessage-members.html
%%QT_DOCDIR%%/qtwidgets/qerrormessage.html
%%QT_DOCDIR%%/qtwidgets/qfiledialog-members.html
%%QT_DOCDIR%%/qtwidgets/qfiledialog-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qfiledialog.html
%%QT_DOCDIR%%/qtwidgets/qfileiconprovider-members.html
%%QT_DOCDIR%%/qtwidgets/qfileiconprovider.html
%%QT_DOCDIR%%/qtwidgets/qfilesystemmodel-members.html
%%QT_DOCDIR%%/qtwidgets/qfilesystemmodel.html
%%QT_DOCDIR%%/qtwidgets/qfocusframe-members.html
%%QT_DOCDIR%%/qtwidgets/qfocusframe.html
%%QT_DOCDIR%%/qtwidgets/qfontcombobox-members.html
%%QT_DOCDIR%%/qtwidgets/qfontcombobox.html
%%QT_DOCDIR%%/qtwidgets/qfontdialog-members.html
%%QT_DOCDIR%%/qtwidgets/qfontdialog.html
%%QT_DOCDIR%%/qtwidgets/qformlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qformlayout.html
%%QT_DOCDIR%%/qtwidgets/qframe-members.html
%%QT_DOCDIR%%/qtwidgets/qframe.html
%%QT_DOCDIR%%/qtwidgets/qgesture-members.html
%%QT_DOCDIR%%/qtwidgets/qgesture.html
%%QT_DOCDIR%%/qtwidgets/qgestureevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgestureevent.html
%%QT_DOCDIR%%/qtwidgets/qgesturerecognizer-members.html
%%QT_DOCDIR%%/qtwidgets/qgesturerecognizer.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsanchor-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsanchor.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsanchorlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsanchorlayout.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsblureffect-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsblureffect.html
%%QT_DOCDIR%%/qtwidgets/qgraphicscolorizeeffect-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicscolorizeeffect.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsdropshadoweffect-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsdropshadoweffect.html
%%QT_DOCDIR%%/qtwidgets/qgraphicseffect-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicseffect.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsellipseitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsellipseitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsgridlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsgridlayout.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitemanimation-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitemanimation-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitemanimation.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitemgroup-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsitemgroup.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslayout-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslayout.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslayoutitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslayoutitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslinearlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslinearlayout.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslineitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicslineitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsobject-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsobject.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsopacityeffect-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsopacityeffect.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspathitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspathitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspixmapitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspixmapitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspolygonitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicspolygonitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsproxywidget-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsproxywidget.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsrectitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsrectitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsrotation-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsrotation.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscale-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscale.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscene-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscene-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscene.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenecontextmenuevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenecontextmenuevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenedragdropevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenedragdropevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssceneevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssceneevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenehelpevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenehelpevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenehoverevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenehoverevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenemouseevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenemouseevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenemoveevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenemoveevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssceneresizeevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssceneresizeevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenewheelevent-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsscenewheelevent.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssimpletextitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicssimpletextitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicstextitem-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicstextitem.html
%%QT_DOCDIR%%/qtwidgets/qgraphicstransform-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicstransform.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsview-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsview-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qgraphicsview.html
%%QT_DOCDIR%%/qtwidgets/qgraphicswidget-members.html
%%QT_DOCDIR%%/qtwidgets/qgraphicswidget.html
%%QT_DOCDIR%%/qtwidgets/qgridlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qgridlayout.html
%%QT_DOCDIR%%/qtwidgets/qgroupbox-members.html
%%QT_DOCDIR%%/qtwidgets/qgroupbox.html
%%QT_DOCDIR%%/qtwidgets/qhboxlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qhboxlayout.html
%%QT_DOCDIR%%/qtwidgets/qheaderview-members.html
%%QT_DOCDIR%%/qtwidgets/qheaderview-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qheaderview.html
%%QT_DOCDIR%%/qtwidgets/qinputdialog-members.html
%%QT_DOCDIR%%/qtwidgets/qinputdialog-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qinputdialog.html
%%QT_DOCDIR%%/qtwidgets/qitemdelegate-members.html
%%QT_DOCDIR%%/qtwidgets/qitemdelegate.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorcreator-members.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorcreator.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorcreatorbase-members.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorcreatorbase.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorfactory-members.html
%%QT_DOCDIR%%/qtwidgets/qitemeditorfactory.html
%%QT_DOCDIR%%/qtwidgets/qkeyeventtransition-members.html
%%QT_DOCDIR%%/qtwidgets/qkeyeventtransition.html
%%QT_DOCDIR%%/qtwidgets/qkeysequenceedit-members.html
%%QT_DOCDIR%%/qtwidgets/qkeysequenceedit.html
%%QT_DOCDIR%%/qtwidgets/qlabel-members.html
%%QT_DOCDIR%%/qtwidgets/qlabel.html
%%QT_DOCDIR%%/qtwidgets/qlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qlayout-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qlayout.html
%%QT_DOCDIR%%/qtwidgets/qlayoutitem-members.html
%%QT_DOCDIR%%/qtwidgets/qlayoutitem.html
%%QT_DOCDIR%%/qtwidgets/qlcdnumber-members.html
%%QT_DOCDIR%%/qtwidgets/qlcdnumber.html
%%QT_DOCDIR%%/qtwidgets/qlineedit-members.html
%%QT_DOCDIR%%/qtwidgets/qlineedit.html
%%QT_DOCDIR%%/qtwidgets/qlistview-members.html
%%QT_DOCDIR%%/qtwidgets/qlistview.html
%%QT_DOCDIR%%/qtwidgets/qlistwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qlistwidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qlistwidget.html
%%QT_DOCDIR%%/qtwidgets/qlistwidgetitem-members.html
%%QT_DOCDIR%%/qtwidgets/qlistwidgetitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qlistwidgetitem.html
%%QT_DOCDIR%%/qtwidgets/qmaccocoaviewcontainer-members.html
%%QT_DOCDIR%%/qtwidgets/qmaccocoaviewcontainer.html
%%QT_DOCDIR%%/qtwidgets/qmacnativewidget-members.html
%%QT_DOCDIR%%/qtwidgets/qmacnativewidget.html
%%QT_DOCDIR%%/qtwidgets/qmainwindow-members.html
%%QT_DOCDIR%%/qtwidgets/qmainwindow.html
%%QT_DOCDIR%%/qtwidgets/qmdiarea-members.html
%%QT_DOCDIR%%/qtwidgets/qmdiarea.html
%%QT_DOCDIR%%/qtwidgets/qmdisubwindow-members.html
%%QT_DOCDIR%%/qtwidgets/qmdisubwindow.html
%%QT_DOCDIR%%/qtwidgets/qmenu-members.html
%%QT_DOCDIR%%/qtwidgets/qmenu-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qmenu.html
%%QT_DOCDIR%%/qtwidgets/qmenubar-members.html
%%QT_DOCDIR%%/qtwidgets/qmenubar.html
%%QT_DOCDIR%%/qtwidgets/qmessagebox-members.html
%%QT_DOCDIR%%/qtwidgets/qmessagebox-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qmessagebox.html
%%QT_DOCDIR%%/qtwidgets/qmouseeventtransition-members.html
%%QT_DOCDIR%%/qtwidgets/qmouseeventtransition.html
%%QT_DOCDIR%%/qtwidgets/qopenglwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qopenglwidget.html
%%QT_DOCDIR%%/qtwidgets/qpangesture-members.html
%%QT_DOCDIR%%/qtwidgets/qpangesture.html
%%QT_DOCDIR%%/qtwidgets/qpinchgesture-members.html
%%QT_DOCDIR%%/qtwidgets/qpinchgesture.html
%%QT_DOCDIR%%/qtwidgets/qplaintextdocumentlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qplaintextdocumentlayout.html
%%QT_DOCDIR%%/qtwidgets/qplaintextedit-members.html
%%QT_DOCDIR%%/qtwidgets/qplaintextedit.html
%%QT_DOCDIR%%/qtwidgets/qprogressbar-members.html
%%QT_DOCDIR%%/qtwidgets/qprogressbar.html
%%QT_DOCDIR%%/qtwidgets/qprogressdialog-members.html
%%QT_DOCDIR%%/qtwidgets/qprogressdialog.html
%%QT_DOCDIR%%/qtwidgets/qproxystyle-members.html
%%QT_DOCDIR%%/qtwidgets/qproxystyle.html
%%QT_DOCDIR%%/qtwidgets/qpushbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qpushbutton.html
%%QT_DOCDIR%%/qtwidgets/qradiobutton-members.html
%%QT_DOCDIR%%/qtwidgets/qradiobutton.html
%%QT_DOCDIR%%/qtwidgets/qrubberband-members.html
%%QT_DOCDIR%%/qtwidgets/qrubberband.html
%%QT_DOCDIR%%/qtwidgets/qscrollarea-members.html
%%QT_DOCDIR%%/qtwidgets/qscrollarea.html
%%QT_DOCDIR%%/qtwidgets/qscrollbar-members.html
%%QT_DOCDIR%%/qtwidgets/qscrollbar.html
%%QT_DOCDIR%%/qtwidgets/qscroller-members.html
%%QT_DOCDIR%%/qtwidgets/qscroller.html
%%QT_DOCDIR%%/qtwidgets/qscrollerproperties-members.html
%%QT_DOCDIR%%/qtwidgets/qscrollerproperties.html
%%QT_DOCDIR%%/qtwidgets/qshortcut-members.html
%%QT_DOCDIR%%/qtwidgets/qshortcut.html
%%QT_DOCDIR%%/qtwidgets/qsizegrip-members.html
%%QT_DOCDIR%%/qtwidgets/qsizegrip.html
%%QT_DOCDIR%%/qtwidgets/qsizepolicy-members.html
%%QT_DOCDIR%%/qtwidgets/qsizepolicy.html
%%QT_DOCDIR%%/qtwidgets/qslider-members.html
%%QT_DOCDIR%%/qtwidgets/qslider.html
%%QT_DOCDIR%%/qtwidgets/qspaceritem-members.html
%%QT_DOCDIR%%/qtwidgets/qspaceritem.html
%%QT_DOCDIR%%/qtwidgets/qspinbox-members.html
%%QT_DOCDIR%%/qtwidgets/qspinbox.html
%%QT_DOCDIR%%/qtwidgets/qsplashscreen-members.html
%%QT_DOCDIR%%/qtwidgets/qsplashscreen.html
%%QT_DOCDIR%%/qtwidgets/qsplitter-members.html
%%QT_DOCDIR%%/qtwidgets/qsplitter-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qsplitter.html
%%QT_DOCDIR%%/qtwidgets/qsplitterhandle-members.html
%%QT_DOCDIR%%/qtwidgets/qsplitterhandle.html
%%QT_DOCDIR%%/qtwidgets/qstackedlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qstackedlayout.html
%%QT_DOCDIR%%/qtwidgets/qstackedwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qstackedwidget.html
%%QT_DOCDIR%%/qtwidgets/qstandarditemeditorcreator-members.html
%%QT_DOCDIR%%/qtwidgets/qstandarditemeditorcreator.html
%%QT_DOCDIR%%/qtwidgets/qstatusbar-members.html
%%QT_DOCDIR%%/qtwidgets/qstatusbar.html
%%QT_DOCDIR%%/qtwidgets/qstyle-members.html
%%QT_DOCDIR%%/qtwidgets/qstyle-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyle.html
%%QT_DOCDIR%%/qtwidgets/qstyleditemdelegate-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleditemdelegate.html
%%QT_DOCDIR%%/qtwidgets/qstylefactory-members.html
%%QT_DOCDIR%%/qtwidgets/qstylefactory.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturn-members.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturn.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturnmask-members.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturnmask.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturnvariant-members.html
%%QT_DOCDIR%%/qtwidgets/qstylehintreturnvariant.html
%%QT_DOCDIR%%/qtwidgets/qstyleoption-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoption-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoption.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionbutton.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptioncombobox-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptioncombobox.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptioncomplex-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptioncomplex.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiondockwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiondockwidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiondockwidget.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionfocusrect-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionfocusrect.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionframe-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionframe-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionframe.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiongraphicsitem-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiongraphicsitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiongraphicsitem.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiongroupbox-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiongroupbox.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionheader-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionheader.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionmenuitem-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionmenuitem.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionprogressbar-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionprogressbar-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionprogressbar.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionrubberband-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionrubberband.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionsizegrip-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionsizegrip.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionslider-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionslider.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionspinbox-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionspinbox.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontab-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontab-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontab.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabbarbase-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabbarbase-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabbarbase.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabwidgetframe-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabwidgetframe-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontabwidgetframe.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontitlebar-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontitlebar.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbar-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbar.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbox-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbox-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbox.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptiontoolbutton.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionviewitem-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionviewitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qstyleoptionviewitem.html
%%QT_DOCDIR%%/qtwidgets/qstylepainter-members.html
%%QT_DOCDIR%%/qtwidgets/qstylepainter.html
%%QT_DOCDIR%%/qtwidgets/qstyleplugin-members.html
%%QT_DOCDIR%%/qtwidgets/qstyleplugin.html
%%QT_DOCDIR%%/qtwidgets/qswipegesture-members.html
%%QT_DOCDIR%%/qtwidgets/qswipegesture.html
%%QT_DOCDIR%%/qtwidgets/qsystemtrayicon-members.html
%%QT_DOCDIR%%/qtwidgets/qsystemtrayicon.html
%%QT_DOCDIR%%/qtwidgets/qtabbar-members.html
%%QT_DOCDIR%%/qtwidgets/qtabbar.html
%%QT_DOCDIR%%/qtwidgets/qtableview-members.html
%%QT_DOCDIR%%/qtwidgets/qtableview-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtableview.html
%%QT_DOCDIR%%/qtwidgets/qtablewidget-members.html
%%QT_DOCDIR%%/qtwidgets/qtablewidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtablewidget.html
%%QT_DOCDIR%%/qtwidgets/qtablewidgetitem-members.html
%%QT_DOCDIR%%/qtwidgets/qtablewidgetitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtablewidgetitem.html
%%QT_DOCDIR%%/qtwidgets/qtablewidgetselectionrange-members.html
%%QT_DOCDIR%%/qtwidgets/qtablewidgetselectionrange.html
%%QT_DOCDIR%%/qtwidgets/qtabwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qtabwidget.html
%%QT_DOCDIR%%/qtwidgets/qtapandholdgesture-members.html
%%QT_DOCDIR%%/qtwidgets/qtapandholdgesture.html
%%QT_DOCDIR%%/qtwidgets/qtapgesture-members.html
%%QT_DOCDIR%%/qtwidgets/qtapgesture.html
%%QT_DOCDIR%%/qtwidgets/qtextbrowser-members.html
%%QT_DOCDIR%%/qtwidgets/qtextbrowser.html
%%QT_DOCDIR%%/qtwidgets/qtextedit-extraselection-members.html
%%QT_DOCDIR%%/qtwidgets/qtextedit-extraselection.html
%%QT_DOCDIR%%/qtwidgets/qtextedit-members.html
%%QT_DOCDIR%%/qtwidgets/qtextedit.html
%%QT_DOCDIR%%/qtwidgets/qtilerules-members.html
%%QT_DOCDIR%%/qtwidgets/qtilerules.html
%%QT_DOCDIR%%/qtwidgets/qtimeedit-members.html
%%QT_DOCDIR%%/qtwidgets/qtimeedit.html
%%QT_DOCDIR%%/qtwidgets/qtoolbar-members.html
%%QT_DOCDIR%%/qtwidgets/qtoolbar.html
%%QT_DOCDIR%%/qtwidgets/qtoolbox-members.html
%%QT_DOCDIR%%/qtwidgets/qtoolbox.html
%%QT_DOCDIR%%/qtwidgets/qtoolbutton-members.html
%%QT_DOCDIR%%/qtwidgets/qtoolbutton.html
%%QT_DOCDIR%%/qtwidgets/qtooltip-members.html
%%QT_DOCDIR%%/qtwidgets/qtooltip.html
%%QT_DOCDIR%%/qtwidgets/qtreeview-members.html
%%QT_DOCDIR%%/qtwidgets/qtreeview-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtreeview.html
%%QT_DOCDIR%%/qtwidgets/qtreewidget-members.html
%%QT_DOCDIR%%/qtwidgets/qtreewidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtreewidget.html
%%QT_DOCDIR%%/qtwidgets/qtreewidgetitem-members.html
%%QT_DOCDIR%%/qtwidgets/qtreewidgetitem-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qtreewidgetitem.html
%%QT_DOCDIR%%/qtwidgets/qtreewidgetitemiterator-members.html
%%QT_DOCDIR%%/qtwidgets/qtreewidgetitemiterator.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-animatedtiles-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-animatedtiles-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-appchooser-appchooser-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-appchooser-appchooser-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-appchooser-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-appchooser-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-animation-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-easing-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-easing-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-form-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-easing-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-moveblocks-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-moveblocks-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-moveblocks-moveblocks-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-states-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-states-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-states-states-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-states-states-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-animation-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-animation-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-graphicsview-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-graphicsview-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-lifecycle-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-lifecycle-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-node-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-node-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-rectbutton-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-rectbutton-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-stickman-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-stickman-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-stickman-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-stickman-stickman-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-animationmanager-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-boat-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-boat-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-boat-p-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-bomb-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-bomb-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-data-xml.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-graphicsscene-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-n810-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-background-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-boat-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-bomb-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sand-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-see-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sky-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-sub-attaq-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-submarine-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-surface-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pics-scalable-torpedo-svg.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-pixmapitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-progressitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-qanimationstate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-states-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-states-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-sub-attaq-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-subattaq-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-submarine-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-submarine-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-submarine-p-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-textinformationitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-animation-sub-attaq-torpedo-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-screenshot-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-screenshot-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-screenshot-screenshot-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-screenshot-screenshot-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-screenshot-screenshot-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-systray-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-systray-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-desktop-systray-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-classwizard-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-classwizard-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-configdialog-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-pages-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-configdialog-pages-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-extension-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-extension-extension-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-extension-finddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-extension-finddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-extension-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-findfiles-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-findfiles-findfiles-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-findfiles-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-findfiles-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-findfiles-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-licensewizard-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-licensewizard-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-sipdialog-dialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-sipdialog-dialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-sipdialog-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-sipdialog-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-sipdialog-sipdialog-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-standarddialogs-dialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-standarddialogs-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-standarddialogs-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-standarddialogs-standarddialogs-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-tabdialog-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-tabdialog-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-tabdialog-tabdialog-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-trivialwizard-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-dialogs-trivialwizard-trivialwizard-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-draggableicons-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-dragwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggableicons-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-draggabletext-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-dragwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-draggabletext-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-droparea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-dropsite-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-dropsitewindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-dropsite-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-draglabel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-dragwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-fridgemagnets-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-fridgemagnets-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-pieceslist-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-puzzle-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-draganddrop-puzzle-puzzlewidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blureffect-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blureffect-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-blurpicker-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-blurpicker-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-fademessage-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-fademessage-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-fademessage-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-fademessage-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-fademessage-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-lighting-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-lighting-lighting-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-lighting-lighting-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-lighting-lighting-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-effects-lighting-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-imagegestures-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-imagewidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-gestures-imagegestures-mainwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-anchorlayout-anchorlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-anchorlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-anchorlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-3rdparty-fbm-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-boxes-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-boxes-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-glbuffers-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-glextensions-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-gltrianglemesh-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-qtbox-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-roundedbox-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-scene-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-scene-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-trackball-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-boxes-trackball-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-chip-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-chip-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-chip-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-images-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-view-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-chip-view-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-collidingmice-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-mice-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-collidingmice-mouse-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-arrow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramscene-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-diagramtextitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-diagramscene-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-coloritem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-dragdroprobot-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-dragdroprobot-robot-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-edge-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-elasticnodes-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-graphwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-elasticnodes-node-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-customproxy-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-flowlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-flowlayout-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-flippablepad-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-form-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-padnavigator-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-roundrectitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-padnavigator-splashitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-simpleanchorlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-index.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-adddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-addressbook-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-addresswidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-newaddresstab-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-addressbook-tablemodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-basicsortfiltermodel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-chart-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-chart-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-pieview-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-chart-pieview-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-coloreditorfactory-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-colorlisteditor-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-coloreditorfactory-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-combowidgetmapper-combowidgetmapper-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-combowidgetmapper-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-combowidgetmapper-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-combowidgetmapper-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-filterwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-dirview-dirview-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-dirview-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-dirview-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-editabletreemodel-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-mainwindow-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-treeitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-editabletreemodel-treemodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-fetchmore-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-filelistmodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-fetchmore-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-freezetablewidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-frozencolumn-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-grades-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-frozencolumn-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-interview-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-interview-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-model-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-interview-model-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-imagemodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-images-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-pixelator-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-pixelator-pixeldelegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-piecesmodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-puzzle-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-puzzle-puzzlewidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-domitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-dommodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpledommodel-simpledommodel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-simpletreemodel-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-treeitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simpletreemodel-treemodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-simplewidgetmapper-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spinboxdelegate-delegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spinboxdelegate-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spinboxdelegate-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spinboxdelegate-spinboxdelegate-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-printview-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheet-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-spreadsheet-spreadsheetitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-stardelegate-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-stareditor-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-itemviews-stardelegate-starrating-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-basiclayouts-basiclayouts-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-basiclayouts-dialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-basiclayouts-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-basiclayouts-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-borderlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-borderlayout-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-dynamiclayouts-dialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-dynamiclayouts-dynamiclayouts-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-dynamiclayouts-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-dynamiclayouts-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-flowlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-layouts-flowlayout-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-application-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-application-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-application-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-dockwidgets-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-dockwidgets-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-colorswatch-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-mainwindow-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mainwindow-toolbar-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mdi-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mdi-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-mdi-mdichild-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-menus-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-menus-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-menus-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-menus-menus-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-sdi-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-mainwindows-sdi-sdi-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-module.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-affine-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-affine-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-xform-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-affine-xform-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-basicdrawing-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-renderarea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-basicdrawing-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-composition-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-composition-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-composition-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-composition-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-composition-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-circlewidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-concentriccircles-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-concentriccircles-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-deform-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-deform-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-pathdeform-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-deform-pathdeform-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-fontsampler-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-fontsampler-mainwindowbase-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-gradients-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-gradients-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-gradients-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-gradients-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-gradients-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposer-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-imagecomposition-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-imagecomposition-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-painterpaths-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-renderarea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-renderarea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-painterpaths-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-pathstroke-pathstroke-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-renderarea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-renderarea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-transformations-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-painting-transformations-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-calendar-calendar-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-calendar-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-calendar-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-calendar-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-calendar-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-detailsdialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-orderform-orderform-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-highlighter-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-syntaxhighlighter-syntaxhighlighter-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-textedit-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-textedit-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-textedit-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-richtext-textedit-textedit-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-eventtransitions-eventtransitions-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-eventtransitions-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-eventtransitions-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-factorial-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-factorial-factorial-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-factorial-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-pingpong-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-pingpong-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-pingpong-pingpong-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-movementtransition-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-rogue-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-rogue-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-trafficlight-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-trafficlight-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-trafficlight-trafficlight-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-twowaybutton-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-twowaybutton-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-statemachine-twowaybutton-twowaybutton-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-codecs-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-previewform-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-codecs-previewform-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-completer-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-completer-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-fsmodel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-fsmodel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-completer-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-customcompleter-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-textedit-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-customcompleter-textedit-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echoplugin-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echointerface-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echowindow-echowindow-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-echowindow-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-plugin-echoplugin-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-echoplugin-plugin-plugin-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-i18n-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-i18n-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-languagechooser-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-languagechooser-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-i18n-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-app-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-interfaces-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-paintarea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-app-plugindialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictools-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafilters-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regexp-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regexp-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regexp-regexp-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regexp-regexpdialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regexp-regexpdialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-regularexpression-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-regularexpression-regularexpressiondialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-locationdialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-settingseditor-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-settingstree-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-settingstree-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-settingseditor-variantdelegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-plugin-plugin-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyle-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-plugin-simplestyleplugin-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-styleplugin-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-styleplugin-stylewindow-stylewindow-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-treemodelcompleter-treemodelcompleter-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-commands-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-commands-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-document-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-document-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-mainwindow-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-undo-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undo-undo-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-commands-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-commands-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-diagramitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-diagramitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-diagramscene-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-diagramscene-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-undoframework-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tools-undoframework-undoframework-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part1-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part1-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part1-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part1-part1-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part2-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part2-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part2-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part2-part2-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part3-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part3-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part3-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part3-part3-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part4-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part4-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part4-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part4-part4-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-finddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part5-part5-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-finddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part6-part6-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-addressbook-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-finddialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-addressbook-part7-part7-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-childwidget-childwidget-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-childwidget-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-childwidget-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-nestedlayouts-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-toplevel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-toplevel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-toplevel-toplevel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-windowlayout-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-analogclock-analogclock-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-analogclock-analogclock-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-analogclock-analogclock-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-analogclock-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-analogclock-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-button-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-button-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-calculator-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-calculator-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-calculator-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calculator-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calendarwidget-calendarwidget-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calendarwidget-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calendarwidget-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calendarwidget-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-calendarwidget-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-charactermap-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-characterwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-charactermap-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-codeeditor-codeeditor-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-codeeditor-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-codeeditor-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-digitalclock-digitalclock-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-digitalclock-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-digitalclock-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-elidedlabel-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-elidedlabel-testwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-groupbox-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-groupbox-groupbox-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-groupbox-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-groupbox-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-groupbox-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-iconpreviewarea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-icons-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-iconsizespinbox-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-imagedelegate-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-imagedelegate-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-icons-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-imageviewer-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-imageviewer-imageviewer-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-imageviewer-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-lineedits-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-lineedits-lineedits-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-lineedits-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-lineedits-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-lineedits-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-mousebuttons-buttontester-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-mousebuttons-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-mousebuttons-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-mousebuttons-mousebuttons-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-movie-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-movie-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-movie-movie-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-movie-movieplayer-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-movie-movieplayer-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-scribble-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-scribblearea-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-scribble-scribblearea-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-shapedclock-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-shapedclock-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-shapedclock-shapedclock-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-sliders-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-slidersgroup-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-sliders-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-spinboxes-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-spinboxes-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-spinboxes-spinboxes-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-spinboxes-window-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-spinboxes-window-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-norwegianwoodstyle-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-styles-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-styles-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-widgetgallery-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-styles-widgetgallery-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-layouts-default-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-layouts-pagefold-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-mainwindow-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-stylesheet-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-stylesheet-stylesheeteditor-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-images-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-mainwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-mainwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-tablet-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-tabletapplication-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tablet-tabletcanvas-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrix-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixboard-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixpiece-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tetrix-tetrixwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-shapeitem-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-sortingbox-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-tooltips-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-tooltips-tooltips-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-ledwidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-ledwidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-localeselector-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-localeselector-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-validators-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-validators-qrc.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-validators-validators-ui.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-dialog-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-dialog-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-wiggly-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-wiggly-wigglywidget-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-controllerwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-example.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-main-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-cpp.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-previewwindow-h.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets-widgets-windowflags-windowflags-pro.html
%%QT_DOCDIR%%/qtwidgets/qtwidgets.index
%%QT_DOCDIR%%/qtwidgets/qtwidgets.qhp
%%QT_DOCDIR%%/qtwidgets/qtwidgets.qhp.sha1
%%QT_DOCDIR%%/qtwidgets/qtwidgets.tags
%%QT_DOCDIR%%/qtwidgets/qundocommand-members.html
%%QT_DOCDIR%%/qtwidgets/qundocommand.html
%%QT_DOCDIR%%/qtwidgets/qundogroup-members.html
%%QT_DOCDIR%%/qtwidgets/qundogroup.html
%%QT_DOCDIR%%/qtwidgets/qundostack-members.html
%%QT_DOCDIR%%/qtwidgets/qundostack.html
%%QT_DOCDIR%%/qtwidgets/qundoview-members.html
%%QT_DOCDIR%%/qtwidgets/qundoview.html
%%QT_DOCDIR%%/qtwidgets/qvboxlayout-members.html
%%QT_DOCDIR%%/qtwidgets/qvboxlayout.html
%%QT_DOCDIR%%/qtwidgets/qwhatsthis-members.html
%%QT_DOCDIR%%/qtwidgets/qwhatsthis.html
%%QT_DOCDIR%%/qtwidgets/qwidget-members.html
%%QT_DOCDIR%%/qtwidgets/qwidget-obsolete.html
%%QT_DOCDIR%%/qtwidgets/qwidget-styling.html
%%QT_DOCDIR%%/qtwidgets/qwidget.html
%%QT_DOCDIR%%/qtwidgets/qwidgetaction-members.html
%%QT_DOCDIR%%/qtwidgets/qwidgetaction.html
%%QT_DOCDIR%%/qtwidgets/qwidgetitem-members.html
%%QT_DOCDIR%%/qtwidgets/qwidgetitem.html
%%QT_DOCDIR%%/qtwidgets/qwizard-members.html
%%QT_DOCDIR%%/qtwidgets/qwizard.html
%%QT_DOCDIR%%/qtwidgets/qwizardpage-members.html
%%QT_DOCDIR%%/qtwidgets/qwizardpage.html
%%QT_DOCDIR%%/qtwidgets/standard-dialogs.html
%%QT_DOCDIR%%/qtwidgets/style-reference.html
%%QT_DOCDIR%%/qtwidgets/style/offline-simple.css
%%QT_DOCDIR%%/qtwidgets/style/offline.css
%%QT_DOCDIR%%/qtwidgets/stylesheet-customizing.html
%%QT_DOCDIR%%/qtwidgets/stylesheet-designer.html
%%QT_DOCDIR%%/qtwidgets/stylesheet-examples.html
%%QT_DOCDIR%%/qtwidgets/stylesheet-reference.html
%%QT_DOCDIR%%/qtwidgets/stylesheet-syntax.html
%%QT_DOCDIR%%/qtwidgets/stylesheet.html
%%QT_DOCDIR%%/qtwidgets/textedit-example.html
%%QT_DOCDIR%%/qtwidgets/tutorials-addressbook.html
%%QT_DOCDIR%%/qtwidgets/widget-classes.html
%%QT_DOCDIR%%/qtwidgets/widgets-tutorial.html
%%QT_DOCDIR%%/qtwinextras.qch
%%QT_DOCDIR%%/qtwinextras/examples-manifest.xml
%%QT_DOCDIR%%/qtwinextras/examples-qtwinextras.html
%%QT_DOCDIR%%/qtwinextras/images/arrow_bc.png
%%QT_DOCDIR%%/qtwinextras/images/bgrContent.png
%%QT_DOCDIR%%/qtwinextras/images/btn_next.png
%%QT_DOCDIR%%/qtwinextras/images/btn_prev.png
%%QT_DOCDIR%%/qtwinextras/images/bullet_dn.png
%%QT_DOCDIR%%/qtwinextras/images/bullet_sq.png
%%QT_DOCDIR%%/qtwinextras/images/glass.png
%%QT_DOCDIR%%/qtwinextras/images/home.png
%%QT_DOCDIR%%/qtwinextras/images/ico_note.png
%%QT_DOCDIR%%/qtwinextras/images/ico_note_attention.png
%%QT_DOCDIR%%/qtwinextras/images/ico_out.png
%%QT_DOCDIR%%/qtwinextras/images/jumplist.png
%%QT_DOCDIR%%/qtwinextras/images/logo.png
%%QT_DOCDIR%%/qtwinextras/images/peek-on.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-musicplayer-composited.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-musicplayer-non-composited.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-musicplayer-taskbar.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-musicplayer-thumbnail.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-quickplayer-composited.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-quickplayer-non-composited.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-quickplayer-taskbar.png
%%QT_DOCDIR%%/qtwinextras/images/qtwinextras-quickplayer-thumbnail.png
%%QT_DOCDIR%%/qtwinextras/images/taskbar-button.png
%%QT_DOCDIR%%/qtwinextras/images/taskbar-progress-indeterminate.png
%%QT_DOCDIR%%/qtwinextras/images/taskbar-progress-paused.png
%%QT_DOCDIR%%/qtwinextras/images/taskbar-progress-stopped.png
%%QT_DOCDIR%%/qtwinextras/images/taskbar-progress.png
%%QT_DOCDIR%%/qtwinextras/images/thumbbar.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-16.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-pause-32.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-play-16.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-play-32.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-backward-32.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-seek-forward-32.png
%%QT_DOCDIR%%/qtwinextras/images/used-in-examples/quickplayer/images/media-stop-32.png
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-dwmfeatures-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-dwmfeatures.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplist-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplist.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistcategory-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistcategory.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistdestination-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistdestination.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistlink-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistlink.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistseparator-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-jumplistseparator.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-taskbarbutton-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-taskbarbutton.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-thumbnailtoolbar-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-thumbnailtoolbar.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-thumbnailtoolbutton-members.html
%%QT_DOCDIR%%/qtwinextras/qml-qtwinextras-thumbnailtoolbutton.html
%%QT_DOCDIR%%/qtwinextras/qtwin.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-iconextractor-example.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-iconextractor-iconextractor-pro.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-iconextractor-main-cpp.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-index.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-module.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-example.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-main-cpp.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-musicplayer-cpp.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-musicplayer-h.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-musicplayer-pro.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-volumebutton-cpp.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-musicplayer-volumebutton-h.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-overview.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-qmlmodule.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-quickplayer-example.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-quickplayer-main-cpp.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-quickplayer-qml-main-qml.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-quickplayer-quickplayer-pro.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras-quickplayer-quickplayer-qrc.html
%%QT_DOCDIR%%/qtwinextras/qtwinextras.index
%%QT_DOCDIR%%/qtwinextras/qtwinextras.qhp
%%QT_DOCDIR%%/qtwinextras/qtwinextras.qhp.sha1
%%QT_DOCDIR%%/qtwinextras/qwinjumplist-members.html
%%QT_DOCDIR%%/qtwinextras/qwinjumplist.html
%%QT_DOCDIR%%/qtwinextras/qwinjumplistcategory-members.html
%%QT_DOCDIR%%/qtwinextras/qwinjumplistcategory.html
%%QT_DOCDIR%%/qtwinextras/qwinjumplistitem-members.html
%%QT_DOCDIR%%/qtwinextras/qwinjumplistitem.html
%%QT_DOCDIR%%/qtwinextras/qwinmime-members.html
%%QT_DOCDIR%%/qtwinextras/qwinmime.html
%%QT_DOCDIR%%/qtwinextras/qwintaskbarbutton-members.html
%%QT_DOCDIR%%/qtwinextras/qwintaskbarbutton.html
%%QT_DOCDIR%%/qtwinextras/qwintaskbarprogress-members.html
%%QT_DOCDIR%%/qtwinextras/qwintaskbarprogress.html
%%QT_DOCDIR%%/qtwinextras/qwinthumbnailtoolbar-members.html
%%QT_DOCDIR%%/qtwinextras/qwinthumbnailtoolbar.html
%%QT_DOCDIR%%/qtwinextras/qwinthumbnailtoolbutton-members.html
%%QT_DOCDIR%%/qtwinextras/qwinthumbnailtoolbutton.html
%%QT_DOCDIR%%/qtwinextras/style/offline-simple.css
%%QT_DOCDIR%%/qtwinextras/style/offline.css
%%QT_DOCDIR%%/qtx11extras.qch
%%QT_DOCDIR%%/qtx11extras/images/arrow_bc.png
%%QT_DOCDIR%%/qtx11extras/images/bgrContent.png
%%QT_DOCDIR%%/qtx11extras/images/btn_next.png
%%QT_DOCDIR%%/qtx11extras/images/btn_prev.png
%%QT_DOCDIR%%/qtx11extras/images/bullet_dn.png
%%QT_DOCDIR%%/qtx11extras/images/bullet_sq.png
%%QT_DOCDIR%%/qtx11extras/images/home.png
%%QT_DOCDIR%%/qtx11extras/images/ico_note.png
%%QT_DOCDIR%%/qtx11extras/images/ico_note_attention.png
%%QT_DOCDIR%%/qtx11extras/images/ico_out.png
%%QT_DOCDIR%%/qtx11extras/images/logo.png
%%QT_DOCDIR%%/qtx11extras/qtx11extras-index.html
%%QT_DOCDIR%%/qtx11extras/qtx11extras-module.html
%%QT_DOCDIR%%/qtx11extras/qtx11extras.index
%%QT_DOCDIR%%/qtx11extras/qtx11extras.qhp
%%QT_DOCDIR%%/qtx11extras/qtx11extras.qhp.sha1
%%QT_DOCDIR%%/qtx11extras/qx11info-members.html
%%QT_DOCDIR%%/qtx11extras/qx11info.html
%%QT_DOCDIR%%/qtx11extras/style/offline-simple.css
%%QT_DOCDIR%%/qtx11extras/style/offline.css
%%QT_DOCDIR%%/qtxml.qch
%%QT_DOCDIR%%/qtxml/examples-manifest.xml
%%QT_DOCDIR%%/qtxml/images/arrow_bc.png
%%QT_DOCDIR%%/qtxml/images/bgrContent.png
%%QT_DOCDIR%%/qtxml/images/btn_next.png
%%QT_DOCDIR%%/qtxml/images/btn_prev.png
%%QT_DOCDIR%%/qtxml/images/bullet_dn.png
%%QT_DOCDIR%%/qtxml/images/bullet_sq.png
%%QT_DOCDIR%%/qtxml/images/dombookmarks-example.png
%%QT_DOCDIR%%/qtxml/images/home.png
%%QT_DOCDIR%%/qtxml/images/ico_note.png
%%QT_DOCDIR%%/qtxml/images/ico_note_attention.png
%%QT_DOCDIR%%/qtxml/images/ico_out.png
%%QT_DOCDIR%%/qtxml/images/logo.png
%%QT_DOCDIR%%/qtxml/images/saxbookmarks-example.png
%%QT_DOCDIR%%/qtxml/images/xmlstreamexample-filemenu.png
%%QT_DOCDIR%%/qtxml/images/xmlstreamexample-helpmenu.png
%%QT_DOCDIR%%/qtxml/images/xmlstreamexample-screenshot.png
%%QT_DOCDIR%%/qtxml/qdomattr-members.html
%%QT_DOCDIR%%/qtxml/qdomattr.html
%%QT_DOCDIR%%/qtxml/qdomcdatasection-members.html
%%QT_DOCDIR%%/qtxml/qdomcdatasection.html
%%QT_DOCDIR%%/qtxml/qdomcharacterdata-members.html
%%QT_DOCDIR%%/qtxml/qdomcharacterdata.html
%%QT_DOCDIR%%/qtxml/qdomcomment-members.html
%%QT_DOCDIR%%/qtxml/qdomcomment.html
%%QT_DOCDIR%%/qtxml/qdomdocument-members.html
%%QT_DOCDIR%%/qtxml/qdomdocument.html
%%QT_DOCDIR%%/qtxml/qdomdocumentfragment-members.html
%%QT_DOCDIR%%/qtxml/qdomdocumentfragment.html
%%QT_DOCDIR%%/qtxml/qdomdocumenttype-members.html
%%QT_DOCDIR%%/qtxml/qdomdocumenttype.html
%%QT_DOCDIR%%/qtxml/qdomelement-members.html
%%QT_DOCDIR%%/qtxml/qdomelement.html
%%QT_DOCDIR%%/qtxml/qdomentity-members.html
%%QT_DOCDIR%%/qtxml/qdomentity.html
%%QT_DOCDIR%%/qtxml/qdomentityreference-members.html
%%QT_DOCDIR%%/qtxml/qdomentityreference.html
%%QT_DOCDIR%%/qtxml/qdomimplementation-members.html
%%QT_DOCDIR%%/qtxml/qdomimplementation.html
%%QT_DOCDIR%%/qtxml/qdomnamednodemap-members.html
%%QT_DOCDIR%%/qtxml/qdomnamednodemap.html
%%QT_DOCDIR%%/qtxml/qdomnode-members.html
%%QT_DOCDIR%%/qtxml/qdomnode.html
%%QT_DOCDIR%%/qtxml/qdomnodelist-members.html
%%QT_DOCDIR%%/qtxml/qdomnodelist.html
%%QT_DOCDIR%%/qtxml/qdomnotation-members.html
%%QT_DOCDIR%%/qtxml/qdomnotation.html
%%QT_DOCDIR%%/qtxml/qdomprocessinginstruction-members.html
%%QT_DOCDIR%%/qtxml/qdomprocessinginstruction.html
%%QT_DOCDIR%%/qtxml/qdomtext-members.html
%%QT_DOCDIR%%/qtxml/qdomtext.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-dombookmarks-pro.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-example.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-main-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-mainwindow-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-mainwindow-h.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-xbeltree-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-dombookmarks-xbeltree-h.html
%%QT_DOCDIR%%/qtxml/qtxml-index.html
%%QT_DOCDIR%%/qtxml/qtxml-module.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-example.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-main-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-mainwindow-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-mainwindow-h.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-saxbookmarks-pro.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-xbelgenerator-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-xbelgenerator-h.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-xbelhandler-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-saxbookmarks-xbelhandler-h.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-example.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-main-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-mainwindow-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-mainwindow-h.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-streambookmarks-pro.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-xbelreader-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-xbelreader-h.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-xbelwriter-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-streambookmarks-xbelwriter-h.html
%%QT_DOCDIR%%/qtxml/qtxml-xmlstreamlint-example.html
%%QT_DOCDIR%%/qtxml/qtxml-xmlstreamlint-main-cpp.html
%%QT_DOCDIR%%/qtxml/qtxml-xmlstreamlint-xmlstreamlint-pro.html
%%QT_DOCDIR%%/qtxml/qtxml.index
%%QT_DOCDIR%%/qtxml/qtxml.qhp
%%QT_DOCDIR%%/qtxml/qtxml.qhp.sha1
%%QT_DOCDIR%%/qtxml/qtxml.tags
%%QT_DOCDIR%%/qtxml/qxmlattributes-members.html
%%QT_DOCDIR%%/qtxml/qxmlattributes.html
%%QT_DOCDIR%%/qtxml/qxmlcontenthandler-members.html
%%QT_DOCDIR%%/qtxml/qxmlcontenthandler.html
%%QT_DOCDIR%%/qtxml/qxmldeclhandler-members.html
%%QT_DOCDIR%%/qtxml/qxmldeclhandler.html
%%QT_DOCDIR%%/qtxml/qxmldefaulthandler-members.html
%%QT_DOCDIR%%/qtxml/qxmldefaulthandler.html
%%QT_DOCDIR%%/qtxml/qxmldtdhandler-members.html
%%QT_DOCDIR%%/qtxml/qxmldtdhandler.html
%%QT_DOCDIR%%/qtxml/qxmlentityresolver-members.html
%%QT_DOCDIR%%/qtxml/qxmlentityresolver.html
%%QT_DOCDIR%%/qtxml/qxmlerrorhandler-members.html
%%QT_DOCDIR%%/qtxml/qxmlerrorhandler.html
%%QT_DOCDIR%%/qtxml/qxmlinputsource-members.html
%%QT_DOCDIR%%/qtxml/qxmlinputsource.html
%%QT_DOCDIR%%/qtxml/qxmllexicalhandler-members.html
%%QT_DOCDIR%%/qtxml/qxmllexicalhandler.html
%%QT_DOCDIR%%/qtxml/qxmllocator-members.html
%%QT_DOCDIR%%/qtxml/qxmllocator.html
%%QT_DOCDIR%%/qtxml/qxmlnamespacesupport-members.html
%%QT_DOCDIR%%/qtxml/qxmlnamespacesupport.html
%%QT_DOCDIR%%/qtxml/qxmlparseexception-members.html
%%QT_DOCDIR%%/qtxml/qxmlparseexception.html
%%QT_DOCDIR%%/qtxml/qxmlreader-members.html
%%QT_DOCDIR%%/qtxml/qxmlreader-obsolete.html
%%QT_DOCDIR%%/qtxml/qxmlreader.html
%%QT_DOCDIR%%/qtxml/qxmlsimplereader-members.html
%%QT_DOCDIR%%/qtxml/qxmlsimplereader.html
%%QT_DOCDIR%%/qtxml/style/offline-simple.css
%%QT_DOCDIR%%/qtxml/style/offline.css
%%QT_DOCDIR%%/qtxml/xml-dom-tml.html
%%QT_DOCDIR%%/qtxml/xml-namespaces.html
%%QT_DOCDIR%%/qtxml/xml-processing.html
%%QT_DOCDIR%%/qtxml/xml-sax.html
%%QT_DOCDIR%%/qtxml/xml-streaming.html
%%QT_DOCDIR%%/qtxml/xml-tools.html
%%QT_DOCDIR%%/qtxmlpatterns.qch
%%QT_DOCDIR%%/qtxmlpatterns/examples-manifest.xml
%%QT_DOCDIR%%/qtxmlpatterns/images/arrow_bc.png
%%QT_DOCDIR%%/qtxmlpatterns/images/bgrContent.png
%%QT_DOCDIR%%/qtxmlpatterns/images/btn_next.png
%%QT_DOCDIR%%/qtxmlpatterns/images/btn_prev.png
%%QT_DOCDIR%%/qtxmlpatterns/images/bullet_dn.png
%%QT_DOCDIR%%/qtxmlpatterns/images/bullet_sq.png
%%QT_DOCDIR%%/qtxmlpatterns/images/filetree_1-example.png
%%QT_DOCDIR%%/qtxmlpatterns/images/filetree_2-example.png
%%QT_DOCDIR%%/qtxmlpatterns/images/home.png
%%QT_DOCDIR%%/qtxmlpatterns/images/ico_note.png
%%QT_DOCDIR%%/qtxmlpatterns/images/ico_note_attention.png
%%QT_DOCDIR%%/qtxmlpatterns/images/ico_out.png
%%QT_DOCDIR%%/qtxmlpatterns/images/logo.png
%%QT_DOCDIR%%/qtxmlpatterns/images/patternist-wordProcessor.png
%%QT_DOCDIR%%/qtxmlpatterns/images/recipes-example.png
%%QT_DOCDIR%%/qtxmlpatterns/images/schema-example.png
%%QT_DOCDIR%%/qtxmlpatterns/qabstractmessagehandler-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstractmessagehandler.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstracturiresolver-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstracturiresolver.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstractxmlnodemodel-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstractxmlnodemodel.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstractxmlreceiver-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qabstractxmlreceiver.html
%%QT_DOCDIR%%/qtxmlpatterns/qsimplexmlnodemodel-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qsimplexmlnodemodel.html
%%QT_DOCDIR%%/qtxmlpatterns/qsourcelocation-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qsourcelocation.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-example.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-filetree-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-filetree-h.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-filetree-pro.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-forms-mainwindow-ui.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-main-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-mainwindow-h.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-queries-listcppfiles-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-queries-qrc.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-filetree-queries-wholetree-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-index.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-module.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-example.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-allrecipes-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-cookbook-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-liquidingredientsinsoup-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-mushroomsoup-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationlessthan30-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-files-preparationtimes-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-forms-querywidget-mobiles-ui.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-forms-querywidget-ui.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-main-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-querymainwindow-h.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-recipes-pro.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-recipes-recipes-qrc.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-example.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-contact-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-order-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-invalid-recipe-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-valid-contact-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-valid-order-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-files-valid-recipe-xml.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-main-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-mainwindow-h.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-schema-mobiles-ui.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-schema-pro.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-schema-qrc.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-schema-schema-ui.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-xquery-example.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-globals-cpp.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-xquery-globalvariables-reportglobals-xq.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns-xquery-xquery-pro.html
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns.index
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns.qhp
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns.qhp.sha1
%%QT_DOCDIR%%/qtxmlpatterns/qtxmlpatterns.tags
%%QT_DOCDIR%%/qtxmlpatterns/qxmlformatter-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlformatter.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlitem-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlitem.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlname-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlname.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlnamepool-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlnamepool.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlnodemodelindex-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlnodemodelindex.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlquery-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlquery.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlresultitems-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlresultitems.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlschema-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlschema.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlschemavalidator-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlschemavalidator.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlserializer-members.html
%%QT_DOCDIR%%/qtxmlpatterns/qxmlserializer.html
%%QT_DOCDIR%%/qtxmlpatterns/style/offline-simple.css
%%QT_DOCDIR%%/qtxmlpatterns/style/offline.css
%%QT_DOCDIR%%/qtxmlpatterns/xmlpattern-examples.html
%%QT_DOCDIR%%/qtxmlpatterns/xmlprocessing.html
%%QT_DOCDIR%%/qtxmlpatterns/xquery-introduction.html